Epilithonimonas zeae: KI430_11375 Help Entry KI430_11375       CDS       T08226                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eze  Epilithonimonas zeae Pathway eze01100   Metabolic pathways eze01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eze00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KI430_11375    00074 Mycolic acid biosynthesis     KI430_11375   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KI430_11375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UQB67636 LinkDB All DBs Position 2529527..2529784 Genome browser AA seq 85 aa AA seqDB search MSDLKLELKNKIVDVLNLEDVAVEDIKDNDPLFGGGLGLDSIDALELIVLLEKEYGIKLS DPKKGKEIFQSIEVMAKFIEENRTK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcgacttaaaattagaattaaaaaacaaaatcgtagatgttcttaacctggaagat gttgctgtagaagacatcaaagacaacgatccgcttttcgggggtggtcttggattggat tctatcgacgctttggaattaatcgttcttcttgaaaaggaatacggaatcaaattatct gacccgaaaaaagggaaagaaatcttccaatctattgaagtaatggcgaaattcattgaa gaaaatcgtacaaaataa

DBGET integrated database retrieval system