Filifactor alocis: HMPREF0389_00939 Help Entry HMPREF0389_00939  CDS       T01663                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism faa  Filifactor alocis Pathway faa01100   Metabolic pathways faa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:faa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HMPREF0389_00939 (acpP)    00074 Mycolic acid biosynthesis     HMPREF0389_00939 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HMPREF0389_00939 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF3219 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  EFE29017 UniProt:  D6GQG4 LinkDB All DBs Position complement(1570246..1570473) Genome browser AA seq 75 aa AA seqDB search MTFEKVKETILESLNCKEEKVVPEARLMEDLEMDSLDGADLAMALEDVFSISIPDEEFET MKTVQDIVDYIDSHK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacatttgaaaaagtaaaagaaacaattttggaaagtttgaactgtaaagaagaaaaa gtagtaccggaagcaagattgatggaagatttggaaatggattctttggatggtgccgat ttggcaatggcattggaagatgtattctcaatctccattccggatgaagaatttgagacg atgaaaacggtacaagacattgtagattatattgacagccacaagtag

DBGET integrated database retrieval system