Ferroplasma acidarmanus: FACI_IFERC01G1317 Help Entry FACI_IFERC01G1317 CDS       T02713                                  Name (GenBank) 50S ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism fac  Ferroplasma acidarmanus Pathway fac03010   Ribosome Brite KEGG Orthology (KO) [BR:fac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     FACI_IFERC01G1317   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     FACI_IFERC01G1317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:fac03011]     FACI_IFERC01G1317    04121 Ubiquitin system [BR:fac04121]     FACI_IFERC01G1317 Ribosome [BR:fac03011]  Ribosomal proteins   Eukaryotes    Large subunit     FACI_IFERC01G1317   Archaea     FACI_IFERC01G1317 Ubiquitin system [BR:fac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    FACI_IFERC01G1317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 Cas12f1-like_TNB Zn_ribbon_ZPR1 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  AGO61297 UniProt:  S0ARA6 LinkDB All DBs Position complement(1285597..1285746) Genome browser AA seq 49 aa AA seqDB search MPFAEAIERRLTRKICMKCYARNSINATKCRKCGYTGLRVKSKERKSAK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgccgttcgcagaagcaatagaaagaagattgacacgcaaaatatgtatgaaatgttat gcaagaaattcaataaacgcaacaaaatgcagaaaatgcggttatactggattaagagtc aaatcaaaggagagaaagagtgcaaagtaa

DBGET integrated database retrieval system