Fervidibacillus albus: OE104_04650
Help
Entry
OE104_04650 CDS
T08860
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
faf
Fervidibacillus albus
Pathway
faf00770
Pantothenate and CoA biosynthesis
faf01100
Metabolic pathways
faf01240
Biosynthesis of cofactors
Module
faf_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
faf00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
OE104_04650 (coaD)
Enzymes [BR:
faf01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
OE104_04650 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Citrate_ly_lig
RGS
VirC2
Motif
Other DBs
NCBI-ProteinID:
WAA10612
UniProt:
A0A9E8LW85
LinkDB
All DBs
Position
932536..933027
Genome browser
AA seq
163 aa
AA seq
DB search
MQRIAVCPGSFDPITNGHMDIIGRGAQIFDKVYVCILNNSSKKSLFTKEERIRLIEEATK
CFPNVVVDAYNGLLVDYAKKVDAQVILRGLRAVSDFEYEMRITSMNRKLDEQIETFFMMT
NNQYSFLSSSIVKEVAKYNGNISDLVPPVVEKALKEKYMRKEQ
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgcaacgaatagcggtttgccctggaagtttcgatccgattacaaatgggcatatggat
attatcggtaggggcgcacaaatatttgataaagtgtatgtatgtatattgaataactcg
agtaaaaagtcgctttttacgaaggaagaaagaatccgtttaatagaagaagcgacaaaa
tgtttcccgaacgtggtcgtggatgcttataacggattgttagttgattatgctaagaaa
gtcgatgcccaagtaatcttaaggggattacgggccgtatcggattttgaatatgaaatg
cggattacatcgatgaacagaaaactcgatgagcaaatcgaaacgtttttcatgatgacg
aataatcaatattcatttctaagttcaagcatcgtaaaagaagtggcaaaatataatggg
aatatttcagacctcgtaccgcccgtcgtcgaaaaggcgttgaaggaaaagtatatgagg
aaggaacaatag
DBGET
integrated database retrieval system