Faecalibacterium wellingii: MTP37_09325 Help Entry MTP37_09325       CDS       T10369                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fah  Faecalibacterium wellingii Pathway fah01100   Metabolic pathways fah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MTP37_09325 (acpP)    00074 Mycolic acid biosynthesis     MTP37_09325 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MTP37_09325 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 HMG-CoA_red_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  UQK55834 LinkDB All DBs Position 1963702..1963929 Genome browser AA seq 75 aa AA seqDB search MTFEEMKKIVVDTLNCDEDKVTMEASLTEDLEADSLDAVELNMALEDACGVSIPDEELAK LKTVGDIFNYITAHV NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgtttgaagaaatgaagaagatcgttgtcgataccctgaactgcgacgaggacaag gtcacgatggaggccagcctgaccgaggatctggaggctgacagtctggacgctgtggag ctgaacatggctctggaggatgcctgcggcgtgtccatcccggacgaggagctggcaaag ctcaagaccgtgggcgacatcttcaactacatcaccgcacacgtctga

DBGET integrated database retrieval system