Ferriphaselus amnicola: OYT1_ch0272 Help Entry OYT1_ch0272       CDS       T05631                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism fam  Ferriphaselus amnicola Brite KEGG Orthology (KO) [BR:fam00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fam03036]     OYT1_ch0272 Chromosome and associated proteins [BR:fam03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     OYT1_ch0272 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA FlaC_arch CCDC138_cc bZIP_1 ANC1_spectrin ACBP4_C Shugoshin_N Prp19 ADIP COG3_N TMF_DNA_bd RRF_GI Ran-binding Metal_resist DUF6468 HAUS-augmin3 NRBF2 Fzo_mitofusin TSC22 Baculo_PEP_C DUF4404 PilO Motif Other DBs NCBI-ProteinID:  BBE49845 UniProt:  A0A2Z6G8Y4 LinkDB All DBs Position complement(288316..288513) Genome browser AA seq 65 aa AA seqDB search MQNEFNTLEQKLGQLVTLTSRLRSENHQLRQELATALSQNRQYSDKIESVSDRLENLLTQ LPEEA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcaaaacgaattcaacacactggagcaaaaactgggacagttggtaacactgacttcg cgcctgcgctccgagaaccatcaactgcgccaagagctggccactgccctcagtcagaat cgccaatacagcgacaagatcgagagcgtctccgatcgactggaaaacttactgacccaa ctaccggaagaagcatga

DBGET integrated database retrieval system