Falsirhodobacter algicola: GR316_09050 Help Entry GR316_09050       CDS       T07373                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism fap  Falsirhodobacter algicola Brite KEGG Orthology (KO) [BR:fap00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fap03032]     GR316_09050    03036 Chromosome and associated proteins [BR:fap03036]     GR316_09050    03400 DNA repair and recombination proteins [BR:fap03400]     GR316_09050 DNA replication proteins [BR:fap03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GR316_09050 Chromosome and associated proteins [BR:fap03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GR316_09050 DNA repair and recombination proteins [BR:fap03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GR316_09050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 SasG_E Poly_export Motif Other DBs NCBI-ProteinID:  QUS36953 UniProt:  A0A8J8MV89 LinkDB All DBs Position complement(1825480..1825755) Genome browser AA seq 91 aa AA seqDB search MTKTQLVATLAEEMGGDKKTATAALDAIAAVVTREVAAGGAVTLPGIGKVMCRERPERQV RNPATGETMTKPADKQVKVTIAKALKDSVNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccaagacccaactggtcgcaacgctggccgaggaaatgggcggcgacaagaagacc gcaaccgccgcgctggacgcgatcgccgcggtcgtgacgcgcgaagtcgctgccggcggt gccgtcacccttccgggcatcggcaaggtcatgtgccgcgagcgtcccgagcgtcaggtc cgcaaccccgccacgggcgagaccatgaccaagccggccgacaagcaggtgaaggtcacg atcgccaaggcgctgaaagacagcgtcaacggctga

DBGET integrated database retrieval system