Rhodobacteraceae bacterium SC52: G5B39_18520 Help Entry G5B39_18520       CDS       T06457                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism faq  Rhodobacteraceae bacterium SC52 Pathway faq01100   Metabolic pathways faq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:faq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B39_18520    00074 Mycolic acid biosynthesis     G5B39_18520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B39_18520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIE43996 UniProt:  A0A6G6FCG4 LinkDB All DBs Position pSC52_6:complement(53360..53602) Genome browser AA seq 80 aa AA seqDB search MDKASVTQELTEIFEDVMDLDEVTLEDGTTANDIEEWDSLSHVRLIIAIERHYGIKFSNA EIESLKQFGDIVALVLTKAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataaagcaagcgtcacgcaggaattgactgaaattttcgaggacgtaatggacctc gatgaggtcacactcgaagatggcaccacagccaacgacatcgaagaatgggacagcctg agccatgtgcgccttattatcgccattgagcggcattatggcatcaagttttccaacgcc gagatcgaaagcctcaagcagtttggggatattgtcgcgttggttctgacaaaagcggcc tga

DBGET integrated database retrieval system