Fopius arisanus: 105263797 Help Entry 105263797         CDS       T07645                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism fas  Fopius arisanus Pathway fas04013   MAPK signaling pathway - fly fas04068   FoxO signaling pathway fas04137   Mitophagy - animal fas04140   Autophagy - animal fas04150   mTOR signaling pathway fas04213   Longevity regulating pathway - multiple species fas04214   Apoptosis - fly fas04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:fas00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105263797    04068 FoxO signaling pathway     105263797    04150 mTOR signaling pathway     105263797  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105263797    04137 Mitophagy - animal     105263797   09143 Cell growth and death    04214 Apoptosis - fly     105263797  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     105263797   09149 Aging    04213 Longevity regulating pathway - multiple species     105263797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fas04131]     105263797   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:fas04031]     105263797 Membrane trafficking [BR:fas04131]  Endocytosis   Macropinocytosis    Ras GTPases     105263797 GTP-binding proteins [BR:fas04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105263797 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  105263797 NCBI-ProteinID:  XP_011298544 UniProt:  A0A0C9QIW7 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QQSWAVNMSQAREVARQYGVPFVETSAKTRMGVDDAFYTLVREIRKDKEHRGKEKRKRQR AGNSGRRRPRCCLL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataaactagtggttgttggggctggtggtgtcggcaaatcagctcttact attcaacttattcaaaatcattttgtcgatgagtacgatccaacgatagaggattcatat agaaaacaggttgttattgatggggagacttgtcttctggatattttggataccgctgga caggaggagtacagtgcaatgagagatcagtacatgaggaccggggagggatttctctta gtttttgcagttaattccgcgaagagctttgaagacataggaacatacagagaacaaatc aaaagggtgaaagatgcagaggaggtacccatggtattagtcggtaataaatgtgatcta caacaatcgtgggctgtgaatatgtcacaagcgagagaagttgcgcgtcaatatggtgta ccgttcgttgaaacatcagccaaaacacgaatgggtgtagatgatgctttttacacattg gtacgagaaatacgaaaggataaggagcaccggggaaaagagaagagaaaacgtcagaga gccggtaattcaggacgcaggagacccagatgctgtctcctataa

DBGET integrated database retrieval system