KEGG   Fopius arisanus: 105271502
Entry
105271502         CDS       T07645                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
fas  Fopius arisanus
Pathway
fas00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fas00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105271502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fas00199]
    105271502
Enzymes [BR:fas01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105271502
Cytochrome P450 [BR:fas00199]
 Cytochrome P450, animal type
  CYP306 family
   105271502
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105271502
NCBI-ProteinID: XP_011311381
UniProt: A0A0C9RAE0
LinkDB
Position
Unknown
AA seq 484 aa
MWYILATIIISLVIFVSLKDRRKLNLPPGPLPLPVLGNLLSIDPVNPHLSLSKLARRYSG
ICGLRMGSVYTVLLTDPKLIRQAFAKDSFTGRAPLYLTHGIMQGYGIVCAEGDHWKEQRK
FVSSTLKSLGMMKHGGKREKLEERITHSISELLTRLKDTDTVLGVDPLESLHHCLGNLIN
DLVFGQTYGEDDETWKWLRHLQEDGVKHIGIAGPLNFLPFLRHLPRYKNLMKFLIDGKLK
THQVYKKIIESDQEGKESFVSIFAEVMRKRSSNNEDLGSFTDQQFYHLLADLYGAGVDTT
LTTIRWSLLFLAAHPEDQEKIHEEMVESLGEREVVLEDRGRLVYLEASICEAQRIRSVVP
LGIPHGTTEDTTLGDFDIPKGTMVVPFQWAIHMDETYFEDPEVFRPTRFISDDELKRPEA
FLPFLTGKRMCVGDELARWILFLFVGRIIQRFRVSLPPGEKVDLIGDCGITLVPKPHKLI
FSER
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtggtacattctcgcaacaataataatatctctggtgatcttcgtcagtttgaaagac
cggagaaaattgaatcttccgccaggaccacttcctcttccggtactcggtaatctctta
tcaatagacccggtgaaccctcatctgagtctatcaaaactggctcggagatactctgga
atatgcggcctccggatgggctctgtttacacagttttattgacggatcctaaactcatt
aggcaggccttcgctaaggattccttcaccggaagagcacctctctacctgacccacggg
ataatgcagggatacggtatcgtctgcgcggagggtgatcactggaaagaacaacgaaaa
ttcgtgtcctcgaccttgaagagcctggggatgatgaagcacgggggtaagagagaaaaa
ctagaggagagaatcacgcactccatttccgagctgcttacgagactcaaggacacggac
acggttctaggagttgatcctctggagagtctccatcactgcctcgggaacctcatcaat
gacctggtgtttggacagacttatggggaggatgatgagacctggaagtggttgaggcac
ctgcaggaggacggggtcaagcatattggaatcgctgggcccctcaacttcctgcctttt
ctgcgacacctccccaggtacaagaacctcatgaagttcttgattgatgggaaattaaag
acacatcaagtctataaaaaaatcattgagagtgaccaggaaggaaaggaaagtttcgtg
tcgatttttgcagaagtgatgaggaagaggagttctaataatgaagacctggggtctttt
acagatcagcagttttatcatctgcttgcggatctttatggagctggggtggacacaacg
ttgacgacgatcagatggtcattgttgttcctggcggctcatcctgaggaccaggagaag
atccatgaggagatggtggagagtctgggggagagagaggttgttctggaggacagggga
aggttggtgtacctggaggctagcatctgcgaggctcagaggatcaggagtgttgttcct
ttgggaattccgcatggaactacagaggatacgacactaggggactttgatatacccaag
ggaacgatggtggtaccttttcaatgggcaattcacatggatgaaacatacttcgaggac
cctgaggtcttcagacccaccagatttatctcagacgatgagttgaagagacctgaagcg
tttcttccgtttttgacaggaaagcggatgtgcgttggggatgagcttgctaggtggatt
ttatttttgtttgttggcagaattattcagagattcagagtttccttacctccgggtgaa
aaggtcgacttgattggagattgtggaatcactctggtaccaaaaccacataaattaatt
ttttccgaacgttaa

DBGET integrated database retrieval system