Fopius arisanus: 105273127 Help Entry 105273127         CDS       T07645                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism fas  Fopius arisanus Pathway fas04137   Mitophagy - animal fas04140   Autophagy - animal fas04144   Endocytosis fas04145   Phagosome fas04148   Efferocytosis Brite KEGG Orthology (KO) [BR:fas00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105273127    04145 Phagosome     105273127    04140 Autophagy - animal     105273127    04137 Mitophagy - animal     105273127    04148 Efferocytosis     105273127  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fas04131]     105273127   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fas04147]     105273127    04031 GTP-binding proteins [BR:fas04031]     105273127 Membrane trafficking [BR:fas04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105273127 Exosome [BR:fas04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105273127   Exosomal proteins of other body fluids (saliva and urine)    105273127   Exosomal proteins of colorectal cancer cells    105273127   Exosomal proteins of bladder cancer cells    105273127 GTP-binding proteins [BR:fas04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105273127 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 AAA_16 Septin AAA_22 AAA_7 AAA_24 ATPase_2 NTPase_1 AAA_5 NACHT NB-ARC ABC_tran AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  105273127 NCBI-ProteinID:  XP_011313678 UniProt:  A0A0C9RTE0 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVAAPTSFKSLDSWRDEFLIQASPRDPDNFPF VVLGNKIDFENRAVSMKRAQQWCQSKNNIPYFETSAKEAINVEQAFQTIAKNALAQESEV ELYNEFPDQIKLTNDQRTNEKGDSCAC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcctcacgaaagaaagtactgctcaaagtaataatcctcggtgattctggagttggt aaaacatctcttatgaatcagtacgtcaataaaaagtttagtaatcagtacaaagcaact attggtgcagattttctcaccaaggaagtcatggttgatgataggatagttaccatgcag atttgggacacggcgggacaagagagattccaatcactgggtgttgccttctacagaggc gctgattgctgtgttcttgttttcgatgttgcagcacccacttccttcaagtccctcgat tcatggagagatgaatttctcattcaagcatctccgagagatcccgacaattttccgttc gttgttttggggaataaaatcgattttgaaaatagagctgtgtcgatgaaaagagcacaa cagtggtgtcagtctaaaaacaatattccatatttcgagactagtgcgaaggaagctatc aacgtggaacaggcatttcagacgatagcgaagaatgctcttgcccaggagagtgaagtg gagctttataatgaattccctgaccagatcaaactcactaacgaccaaaggaccaatgaa aagggcgactcatgtgcttgctag

DBGET integrated database retrieval system