Frateuria aurantia: Fraau_0075 Help Entry Fraau_0075        CDS       T01773                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism fau  Frateuria aurantia Pathway fau01100   Metabolic pathways fau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Fraau_0075    00074 Mycolic acid biosynthesis     Fraau_0075   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Fraau_0075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFC84575 UniProt:  H8KZR4 LinkDB All DBs Position 85881..86162 Genome browser AA seq 93 aa AA seqDB search MEQTAAQQELAAYIVEALNLEDISPGQIDPQAPLLGGPLGLDSIDALEIALMVSRRYGFQ LRSDDPQNRQIFASLGDLSEYIEQHRQTPARAG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtggaacagaccgcagcacaacaagaattggcagcctacatcgtcgaggccctgaatctg gaagacatcagccccgggcagatcgatccgcaagcccccctgctgggtggcccgctgggc ctggattccatcgatgcactggaaatcgccttgatggtgtcacgccgctacggtttccag ctgcgctccgatgatccgcagaatcggcagatcttcgccagtctgggtgatctttccgaa tatatcgagcagcatcggcagacgccggcacgggctggatga

DBGET integrated database retrieval system