KEGG   Frateuria aurantia: Fraau_0121
Entry
Fraau_0121        CDS       T01773                                 
Name
(GenBank) antirepressor regulating drug resistance protein
  KO
K02172  bla regulator protein blaR1
Organism
fau  Frateuria aurantia
Pathway
fau01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fau00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Fraau_0121
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fau01002]
    Fraau_0121
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:fau01504]
    Fraau_0121
Peptidases and inhibitors [BR:fau01002]
 Metallo peptidases
  Family M56
   Fraau_0121
Antimicrobial resistance genes [BR:fau01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    Fraau_0121
SSDB
Motif
Pfam: Peptidase_M56
Other DBs
NCBI-ProteinID: AFC84621
UniProt: H8L0J5
LinkDB
Position
complement(134929..136710)
AA seq 593 aa
MDVIDRMTSLWLPWLCWTCLQTLLLTGLVALLDRCLPRLSAATRCTLWWLVGLQVLAGLG
WRLRLVWPWPPGDDGLLARLGIPAGDLGVSPPGGGRIRPAMLDDIIVHGLRWLFLAWLGL
LIVQVLISLGQAWQAHALRRRSQPLQQELIRTLAGIQARGMGLRRLPELRTATSLGSPVV
SGLWRPMILLPATCPSAPAEAAMMIAHELAHLRRGDLWLGWVPALARHLLCFHPALLWSN
HAYRLQRESACDSLAMQHSREDPQAYGRLLLQWGAARPSDSQLGSAPSGHRDLQWRLQAL
RRNQAKSPERRWQAVAAMLLSLSGVLPYRLSLADPALQAVQPPPMMTPIIPAMAPLPVPP
PPVISPPRISPPIPTPAPVPAGSGPSSRPPTAWAAFDGQTLYFQGGADDQARFARHRQGQ
QPVFWYRHGQQVWLSHDPVLIRQVVGSLQSPSAMAVRSNALDPAQRALLQQQWLNAREQS
DLAARQADLAASQARNHRARVQQLWQARLRQPPLPAASIAHPLSLSPEPSDTTEMDKLRQ
RQRVLQEQMQDLVRQQQVYATPPQATGSGQAPAKLQRLLEGAVRQGRATPVNP
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggatgtgatcgaccggatgacctcactatggctgccatggctgtgctggacctgtctg
cagaccttgctgctgaccggtctggtggccttgctggatcgctgcctgccaagactctcg
gcggcgacccgctgcacgctgtggtggctggtggggctgcaggtactggcggggctgggc
tggcgacttcggctggtctggccatggccgccaggcgacgatggcctgctggcacggctg
ggtatccctgccggtgacttgggcgtcagcccgcccggcggcggcaggattcgcccggcc
atgctcgacgacatcatcgtccacggtctgcgctggctctttctggcctggctggggctg
ctcatcgtgcaggtgctgatctcgctgggccaggcctggcaggcacatgccctgcgtcgc
cgttcgcagcctctgcagcaggagctgatccggaccctggccggcatccaggcacggggc
atggggctgcggcgactccccgagctgcgcaccgccaccagcctcggctcaccggtggtc
agcggcctgtggcgaccgatgatcctgctgccggcgacctgcccgtcggccccggccgag
gcggcgatgatgattgcccatgaactggcccatctccggcgaggtgatctgtggctgggc
tgggtacccgccctggccagacatctgctgtgcttccatccggccttgctgtggagcaac
catgcctaccgactgcagcgcgaaagcgcctgcgacagtctcgcgatgcagcacagtcgc
gaggatccccaggcctatggacgacttctgctgcaatggggggctgctcggccgtccgat
tcgcaactgggcagtgcccccagcggacaccgcgacctgcaatggcgactgcaggccttg
cgccgcaatcaggcgaagtcgccggagcggcgatggcaggccgtcgccgccatgctgctg
agcctgtcgggggtgctgccatatcgcctgagcctggccgatccagcgctgcaggccgtg
caaccgcccccgatgatgacgccgatcatcccggccatggcgccactgccggtaccgccg
ccgccggtgatcagtccgccacggatttcgccaccgattccgacgccggcgccagtcccc
gctggcagcggcccctcgtcccggcctccgaccgcctgggccgccttcgatggccagacc
ctgtacttccagggcggggccgacgaccaggcacgcttcgctcgccatcggcaaggccag
cagcccgtgttctggtaccgccatggtcagcaggtctggctcagtcatgacccggtcctg
atccggcaggtggtcgggtctctgcagagcccatcagccatggccgtccgcagcaatgca
ctcgatccggcgcagcgggcattgctgcaacagcagtggctcaacgccagagagcaaagc
gatctggccgcgcgccaggccgatctggccgccagtcaggcccggaaccaccgcgcacgg
gtccaacagctgtggcaggcacgtctgcgccagccaccactcccggccgccagcattgcc
cacccgctcagcctctcgccggagccgagcgataccaccgagatggacaaactgcgccag
cgacagcgggtcttgcaggaacagatgcaggatctggtccggcaacagcaggtctatgcc
acgcccccgcaggcaaccggcagcggtcaggccccggcaaaattgcagcggctgctggaa
ggtgccgtacgtcagggccgagccacacccgtcaacccctag

DBGET integrated database retrieval system