KEGG   Frateuria aurantia: Fraau_2155
Entry
Fraau_2155        CDS       T01773                                 
Name
(GenBank) putative taurine catabolism dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
fau  Frateuria aurantia
Pathway
fau00430  Taurine and hypotaurine metabolism
fau00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Fraau_2155
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Fraau_2155
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     Fraau_2155
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: AFC86537
UniProt: H8L461
LinkDB
Position
2282240..2283115
AA seq 291 aa
MSYDISLLSPTLGAVITGLDLGAELDGIPLGRIQADLDRHRVLFFREQSLTPTKQRDLAA
AFGPLHRHPIYPHSEGLPEVLVLDTLQDDLRDNAVWHSDVSFLPAPAAMAVLHADIVPDV
GGDTLWSCQHAAWQALSAPLQRWLGGLQAIHRLDQSFPPQRFGDTPERRARREKALAQHP
PVSHPVVRRHPRTGEASLYVNEGFTAEIEGLAPAESRALLQLLFQHSQRPEFQIRWSWRP
GDVAIWDNRNTLHYACDDYRPQHRRMRRATILGEPPLAMASQDRARSATPA
NT seq 876 nt   +upstreamnt  +downstreamnt
gtgagctacgacatttccctgttgagtcccaccctcggcgccgtgatcacgggcctcgat
ctgggtgcagaacttgacggcatccctctgggccggatccaggccgatctcgaccggcat
cgcgtgctgtttttccgggagcagtcattgacgccgacgaagcaacgcgatctggccgcc
gccttcggccctttgcaccggcaccccatctatccgcacagcgaaggcctgccggaggtg
ctggtgctggataccctgcaggatgatctgcgcgacaacgccgtctggcacagcgacgtc
agctttctgcccgcacccgccgccatggccgtgctccatgccgacatcgtgcctgacgtg
ggtggcgataccctgtggtcctgccagcatgccgcctggcaagcactgtctgcaccgttg
cagcgatggctgggcggattgcaggccatccatcgtctggaccagtccttcccgccccag
cgctttggcgataccccggaacgccgggctcgccgcgaaaaagccctggcccagcacccg
cccgtcagccatcccgtcgtgcgccgacatccgcgcaccggcgaggcctcgctttatgtc
aacgaaggctttactgccgaaatcgaaggcttggcgcccgcagaaagccgggccttgctg
caactcctgttccagcacagccagcggcccgaattccagatccgctggtcatggcgaccc
ggcgatgtcgcgatctgggacaaccgcaacaccttgcactacgcctgcgatgattatcgg
ccgcaacatcgacggatgcggcgcgccaccatcctgggggaaccgccgctggccatggcc
tcgcaagaccgggcacgctcggcaacaccggcctga

DBGET integrated database retrieval system