Firmicutes bacterium ASF500: N510_003423 Help Entry N510_003423       CDS       T10173                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism fbs  Firmicutes bacterium ASF500 Pathway fbs01100   Metabolic pathways fbs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fbs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N510_003423 (acpP_2)    00074 Mycolic acid biosynthesis     N510_003423 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N510_003423 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  USF28462 LinkDB All DBs Position complement(3504860..3505093) Genome browser AA seq 77 aa AA seqDB search MIFEKLAALIAEQFNVDVDTVTMETSFSDDLNADSVDIVDLSMALEEEFGIEELGEEEAS SISTVGDLVRFLQNKID NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgatctttgaaaagctggccgccttgattgccgagcaattcaatgtagacgttgacacc gtcacgatggaaacttctttttccgacgacctgaacgccgattccgtagacattgtggac ctgtccatggccctggaggaggaattcggcattgaggagctgggcgaggaggaggcttcc tccatctccactgtgggcgacctggtccgcttcctccagaataaaatcgactga

DBGET integrated database retrieval system