KEGG   Felis catus (domestic cat): 100125860
Entry
100125860         CDS       T02385                                 
Symbol
CD19
Name
(RefSeq) B-lymphocyte antigen CD19 isoform X3
  KO
K06465  B-lymphocyte antigen CD19
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04640  Hematopoietic cell lineage
fca04662  B cell receptor signaling pathway
fca05169  Epstein-Barr virus infection
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100125860 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100125860 (CD19)
   04662 B cell receptor signaling pathway
    100125860 (CD19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100125860 (CD19)
  09163 Immune disease
   05340 Primary immunodeficiency
    100125860 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    100125860 (CD19)
CD molecules [BR:fca04090]
 Proteins
  100125860 (CD19)
SSDB
Motif
Pfam: V-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100125860
NCBI-ProteinID: XP_003998787
Ensembl: ENSFCAG00000003107
LinkDB
Position
E3:22059420..22065201
AA seq 557 aa
MPPPLLLFFLLFLTPEGVRPQKTLLVEAKEGGKAELPCLKGPSDGPPEQQAWFQGAQSEL
DPGSQGLGIQKGPLGLQLLIFNVSDQMGGFYVCQLGPPSEQAWQSGWTVTVEGSGELFRW
NASYLNDPGCGLGNRSSEGPKPSSGYPTSSQLYVWAKGHPEIWETDPDCASPRGGLDQSL
NQDVTVAPGSTFWLPCEVPPASVARGPISWTLVRPKKHNISLLHLNLREDAPVREMWVLD
TLRGGAVLLLPQATAQDAGTYHCYHGNMTIEMQLKVTAQSVRHWLLEAGGWKVPVVPLLY
LIICLGSLVSFVHLRRALILRKKRKRMTDPTRRFFKVTPSPGSGAQNQYGNVLSLPTPTS
GTGRALRWAAGLGAAVQSYGNPRSDVQEVGAAGPRSPPPAGPEEEEGEAYEEPDSEEGSE
FYENDSNLGQDQLSQDGSGYENPEDDALGPGDEDSFSSAESYENEDEELAQPVARTADFL
SPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSLRAQPGPNHEEDADSYENMDNPNG
PEPAWGGGGRMGTWSTR
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgccacctcctcttctcctcttcttcctcctcttcctcacccctgagggagtcaggccc
cagaaaacactgctggtggaggctaaagagggaggcaaagctgagctgccatgcctcaaa
ggtccctcagatggtccccctgagcagcaggcctggtttcagggggctcagtcagagctg
gacccaggttcacaaggcctgggcatccagaaggggcccctgggcctccagctcctcatc
ttcaacgtctctgaccagatggggggcttctacgtatgccagctggggcccccttctgag
caggcctggcagtctggctggacagtcaccgtggagggcagcggggagctgttccgctgg
aatgcctcatacctaaatgacccaggctgtggcctggggaacaggtcctcagagggcccc
aagccctcttctggttaccccacaagctcccagctgtacgtgtgggccaaaggccaccct
gagatctgggagacagaccctgactgtgcctcgcccaggggcggtctggaccagagcctc
aaccaagacgtcaccgtggcccctggctccacattctggctgccctgtgaggtgccccct
gcctccgtggccagaggccccatctcctggaccctcgtgcgccccaagaagcataacatc
tcattgctgcacttaaacctgagggaggatgccccggtcagagagatgtgggtcctagac
accctcaggggaggggctgttctgttgctgccccaggcgaccgctcaagatgctggcacc
tatcattgttaccatggcaacatgaccatcgagatgcagctgaaggtcactgcccagtca
gtaagacactggctgctggaggctggtggctggaaagtccccgttgtgccattactttat
ctgatcatctgcctgggttccctggtgagctttgttcatcttcgaagagccctgatcctc
aggaagaaaagaaagcgaatgaccgatcccaccagaaggttcttcaaagtgacgccttcc
ccgggaagcggggcgcagaatcagtacgggaacgtgctctcccttcccacgcccacctct
gggacgggacgcgccctaaggtgggctgcaggcctgggggccgccgtccagtcgtacgga
aacccgcgcagcgacgtacaggaggtcggagccgcggggccccggagcccgccaccagca
ggcccagaagaagaggaaggagaagcctatgaggagccggacagtgaggagggctccgag
ttctacgagaatgactccaacctcgggcaggaccagctctcccaggatggcagcggctat
gagaaccctgaggacgacgccttgggtcccggggatgaagactccttctccagcgccgag
tcttatgagaacgaggatgaagagctggcccagccagtcgccaggacagcagatttcctg
agcccccatgggtctgcctgggatcccagcagggaggcaacctctcttgggtcccagtcc
tacgaggatatgagagggatcctgtatgcagccccccagctccgctcccttcgggcccag
ccgggtcctaatcatgaggaagatgcagactcttatgagaacatggacaatcccaatggg
ccagaaccagcatggggaggagggggccgcatgggcacctggagcactaggtga

DBGET integrated database retrieval system