KEGG   Felis catus (domestic cat): 100127110
Entry
100127110         CDS       T02385                                 
Symbol
CD274
Name
(RefSeq) programmed cell death 1 ligand 1
  KO
K06745  programmed cell death 1 ligand 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100127110 (CD274)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100127110 (CD274)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    100127110 (CD274)
CD molecules [BR:fca04090]
 Proteins
  100127110 (CD274)
SSDB
Motif
Pfam: Ig_3 I-set V-set ig Ig_2 C2-set_2 V-set_CD47 Nuc_sug_transp C1-set Ig_6
Other DBs
NCBI-GeneID: 100127110
NCBI-ProteinID: XP_006939101
Ensembl: ENSFCAG00000009047
UniProt: A0A5F5XRI1
LinkDB
Position
D4:complement(6277924..6300876)
AA seq 291 aa
MRIFSVFAFMAYCHLLKAFTITVSKDLYVVEYGSNVTMECRFPVEEQLDLVSLIVYWEME
DKKIIQFVQGKEDLKVQHRSYSQRAQLLKDQLFLGKAALQITNVTLEDAGVYCCLIGYGG
ADYKRITLKVHAPYRKINQRISVDPVTSEHELMCQAEGYPTAEVIWTNSAHQVLNGKTII
SVSNMETKLFNVTSTLRINTTANEIFYCTFLQRSSPEGNSTAELVIPEPFLVPANERTHF
MILGAILLFLVVVPAVTFCLKKRDVRTMDVEKCDTADMNSKKQNDLQFEET
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaggatatttagtgtctttgcattcatggcctactgtcatttgctgaaagcgtttacg
atcacagtgtccaaggacctgtatgtggtagagtacggcagcaatgtgacaatggagtgc
agattccccgtagaagaacaattagacctggtttcactgatcgtctactgggaaatggag
gataagaaaatcattcagtttgtgcaagggaaggaagacctgaaagttcagcacagaagc
tacagtcagagggcccagctgttgaaggaccagctcttcctggggaaggccgcgcttcag
atcacaaacgtgaccctggaggatgccggggtttactgctgcttgattggctatggcggt
gctgactataagcggattactttgaaagttcatgccccatatcgaaaaatcaaccaaaga
atttctgtggatcctgtcacctctgaacatgaactaatgtgtcaggctgagggttaccca
accgctgaagtcatctggacaaacagtgcccatcaagtcctgaatggcaaaaccatcatc
tctgtttccaatatggagacaaagcttttcaatgtgaccagcacgctgagaatcaacaca
acggctaacgagattttctactgcacttttcttcaaagatcaagtcccgagggaaacagt
actgctgagttggtcatcccagaaccatttctggttccagcaaatgagaggactcacttc
atgattctaggagccatcctgttgtttcttgtcgtggtcccggctgtcactttctgtctg
aagaaacgagatgtacgaacgatggatgtggaaaaatgtgacaccgcagatatgaactca
aagaagcaaaatgatctacaatttgaggagacgtaa

DBGET integrated database retrieval system