KEGG   Felis catus (domestic cat): 100127112
Entry
100127112         CDS       T02385                                 
Symbol
MCP-1
Name
(RefSeq) C-C motif chemokine 2
  KO
K14624  C-C motif chemokine 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05135  Yersinia infection
fca05142  Chagas disease
fca05144  Malaria
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05323  Rheumatoid arthritis
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100127112 (MCP-1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100127112 (MCP-1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100127112 (MCP-1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100127112 (MCP-1)
   04657 IL-17 signaling pathway
    100127112 (MCP-1)
   04062 Chemokine signaling pathway
    100127112 (MCP-1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100127112 (MCP-1)
   05164 Influenza A
    100127112 (MCP-1)
   05168 Herpes simplex virus 1 infection
    100127112 (MCP-1)
   05163 Human cytomegalovirus infection
    100127112 (MCP-1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100127112 (MCP-1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100127112 (MCP-1)
   05142 Chagas disease
    100127112 (MCP-1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100127112 (MCP-1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100127112 (MCP-1)
   05418 Fluid shear stress and atherosclerosis
    100127112 (MCP-1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100127112 (MCP-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100127112 (MCP-1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    100127112 (MCP-1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100127112 (MCP-1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   100127112 (MCP-1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100127112
NCBI-ProteinID: XP_003996605
Ensembl: ENSFCAG00000000840
UniProt: M3VVI4
LinkDB
Position
E1:22086052..22087933
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLVSYKRVTSSKCP
KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag
gtgctcgcccagccagatgcaattaattctccagtcacctgctgctatacactcaccaat
aagaagatctcgatgcagaggctggtgagctataaaagagtcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag
aagtgggtcaaggattccatggcacacctggacaagaagacccaaactgcaaagccttga

DBGET integrated database retrieval system