KEGG   Felis catus (domestic cat): 100174789
Entry
100174789         CDS       T02385                                 
Symbol
TNFSF10
Name
(RefSeq) tumor necrosis factor ligand superfamily member 10
  KO
K04721  tumor necrosis factor ligand superfamily member 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04068  FoxO signaling pathway
fca04210  Apoptosis
fca04217  Necroptosis
fca04650  Natural killer cell mediated cytotoxicity
fca05132  Salmonella infection
fca05164  Influenza A
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100174789 (TNFSF10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100174789 (TNFSF10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100174789 (TNFSF10)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100174789 (TNFSF10)
   04217 Necroptosis
    100174789 (TNFSF10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100174789 (TNFSF10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100174789 (TNFSF10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100174789 (TNFSF10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100174789 (TNFSF10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100174789 (TNFSF10)
   04052 Cytokines and growth factors [BR:fca04052]
    100174789 (TNFSF10)
   04090 CD molecules [BR:fca04090]
    100174789 (TNFSF10)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100174789 (TNFSF10)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   100174789 (TNFSF10)
CD molecules [BR:fca04090]
 Proteins
  100174789 (TNFSF10)
SSDB
Motif
Pfam: TNF C1q
Other DBs
NCBI-GeneID: 100174789
NCBI-ProteinID: NP_001124316
Ensembl: ENSFCAG00000011269
UniProt: B4XH67
LinkDB
Position
C2:95939225..95955718
AA seq 281 aa
MQAPAGPSPGQTCVLILIFTVLLQSLCVAVTYMYFTSELRQMQDKYSQSGIACFLKEDDI
PWDPNDEESMNTPCWQVKWQLRQFVRKILRTYEETIPTVPEKQLNIPYLVRERGPQRVAA
HITGTSRRRSTFPVPSSKNEKALGQKINSWESSRKGHSFLNNLHLRNGELVIHQRGFYYI
YSQTYFRFQEPEEIPTGQNRKRNKQMVQYIYKHTSYPDPILLMKSARNSCWSKDSEYGLY
SIYQGGIFELKENDRIFVSVSNEQLIDMDQEASFFGAFLIG
NT seq 846 nt   +upstreamnt  +downstreamnt
atgcaggccccggcgggccccagtcccgggcagacctgcgtgctgatcctgatcttcact
gtgctcctgcagtccctctgcgtggccgtgacttacatgtacttcaccagtgaactgagg
cagatgcaggacaaatactcccaaagtggcattgcttgtttcttaaaggaagacgatatc
ccttgggaccccaatgatgaagagagtatgaacaccccgtgctggcaagtgaaatggcag
ctccgtcagtttgttagaaagattttgagaacctatgaggaaaccattcctacagttcca
gaaaagcagctaaatattccttacctagtaagagaaagaggtcctcagagagtagcagct
cacataactggaaccagtcggagaagaagcacattcccagttccaagctccaagaatgaa
aaagctttgggtcagaaaataaactcctgggagtcatcaagaaaaggacattcattcttg
aataatttgcacttgaggaatggtgagctggttattcatcagagggggttttattacatc
tattcccaaacatactttcgatttcaggaacctgaggaaattccaacaggacagaacaga
aagagaaacaaacaaatggtccaatatatttacaaacacacgagttatccggaccctata
ctgctgatgaaaagtgctagaaatagttgttggtctaaagattctgaatatggactctat
tccatctatcaaggtgggatatttgagcttaaggaaaacgatagaatttttgtctctgta
tctaacgagcaattgattgacatggaccaagaagccagttttttcggggcctttttaatc
ggctaa

DBGET integrated database retrieval system