KEGG   Felis catus (domestic cat): 100191005
Entry
100191005         CDS       T02385                                 
Symbol
CCR3
Name
(RefSeq) C-C chemokine receptor type 3
  KO
K04178  C-C chemokine receptor type 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100191005 (CCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100191005 (CCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100191005 (CCR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100191005 (CCR3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100191005 (CCR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100191005 (CCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    100191005 (CCR3)
   04050 Cytokine receptors [BR:fca04050]
    100191005 (CCR3)
   04090 CD molecules [BR:fca04090]
    100191005 (CCR3)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100191005 (CCR3)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   100191005 (CCR3)
CD molecules [BR:fca04090]
 Proteins
  100191005 (CCR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100191005
NCBI-ProteinID: NP_001129442
Ensembl: ENSFCAG00000030883
UniProt: B6DXF5
LinkDB
Position
A2:15827292..15843937
AA seq 361 aa
MEALMAGTETVTADASVRTTLFDYEFSLPCEKINVKELGSRLLPPLYSLVFVVGLLGNAM
VVVILTKYRRLRIMTNIFLLNLAISDLLFLFTLLFWIHYSRSNEWVFGHFMCKLLSGLYY
MGLYSEIFFIILLTIDRYLAIVHAVFALRTRTVTFGIIMSVLTWGLAGIAALPEFIFHQS
QNDAEQYICLPLYPGGQEDNWKRFHALSMNILSLALPLLIMAVCYAGIIRTLLRCPNKTK
YKAIRLIFVIMVVFFMFWTPYNLVLLLSAFQTIFFEVSCEQSKWLDVAMQVTEVIAYTHC
CVNPVIYAFVGERFREHLSHFFRRHVATNLGKYIPFLPSEKSDRASSGSPSTGEQELSFV
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggaggctttgatggccggaactgagacggtgacagcggatgcgtctgtcaggaccaca
ctgttcgactatgagttctcgctgccatgtgaaaaaatcaacgtcaaggagctggggtcc
cgcctcttgcccccactgtattccctggtgttcgtggttggtctgctgggcaacgcgatg
gtggtggtgatcctcacaaaatacaggaggctccggatcatgaccaacatcttcctactc
aatttggccatttctgacttgctcttcctgttcactctgctgttctggattcactacagc
aggtcgaacgagtgggtgttcggccacttcatgtgtaagctcctctccgggctttactac
atgggcttgtacagcgagattttcttcatcatcctgctgaccatagaccggtacctggcc
atcgtccacgccgtgttcgccctgcggacccggaccgtcactttcggtatcatcatgagc
gtcctcacctggggcctggcagggatagcggccctccctgaatttatcttccatcagtcc
caaaatgatgctgaacagtacatctgtttgcctctttatccaggaggccaagaggataac
tggaagcgtttccatgctctgagcatgaacatcctcagtctggccctgcctctgctcatc
atggccgtctgctacgcgggaattattaggacactgctgagatgccccaataaaaccaag
tacaaggccatccggctcatttttgtcatcatggtggtctttttcatgttctggaccccc
tacaacctggtcctccttctctctgctttccaaacgatcttctttgaggtcagttgtgag
cagagcaaatggctcgatgtggccatgcaggtgacagaggtgatcgcctacacgcactgc
tgcgttaaccccgtcatctacgccttcgtgggggagaggttccgggagcacctcagccac
ttcttccgcaggcacgtggccaccaacctgggcaaatacatcccgttccttcccagcgag
aaatcagaccgagccagctctggctccccatcaacgggggaacaggagctctcttttgtc
ttttag

DBGET integrated database retrieval system