KEGG   Felis catus (domestic cat): 100302541
Entry
100302541         CDS       T02385                                 
Name
(RefSeq) chemokine (C-C motif) ligand 4-like precursor
  KO
K12964  C-C motif chemokine 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100302541
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302541
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302541
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100302541
   04623 Cytosolic DNA-sensing pathway
    100302541
   04062 Chemokine signaling pathway
    100302541
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100302541
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    100302541
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   100302541
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100302541
NCBI-ProteinID: NP_001157130
Ensembl: ENSFCAG00000010008
UniProt: C5NM74
LinkDB
Position
E1:23417954..23419289
AA seq 92 aa
MKLCVTVLSLLVLVAAFCSPTLSAPMGSDPPTACCFSYALRKLPRNFVVDYFETSSLCSQ
PAVVFQTKRGRQVCANPSDSWVQEYMDDLELN
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaaactctgtgtgactgtcctttctctccttgtgctagtggctgccttctgctccccg
acgctctcagcaccaatgggctcagaccctcccaccgcctgctgcttctcttacgccctg
cggaagctccctcgaaactttgtagtggattactttgagaccagcagcctctgctcccag
ccagctgtggtattccaaaccaaaaggggcagacaagtctgtgctaaccccagtgactcc
tgggtccaggaatacatggatgacctggaactgaactga

DBGET integrated database retrieval system