KEGG   Felis catus (domestic cat): 100500937
Entry
100500937         CDS       T02385                                 
Symbol
IGF1R
Name
(RefSeq) insulin-like growth factor 1 receptor isoform X1
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04144  Endocytosis
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04510  Focal adhesion
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04730  Long-term depression
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100500937 (IGF1R)
   04014 Ras signaling pathway
    100500937 (IGF1R)
   04015 Rap1 signaling pathway
    100500937 (IGF1R)
   04066 HIF-1 signaling pathway
    100500937 (IGF1R)
   04068 FoxO signaling pathway
    100500937 (IGF1R)
   04151 PI3K-Akt signaling pathway
    100500937 (IGF1R)
   04152 AMPK signaling pathway
    100500937 (IGF1R)
   04150 mTOR signaling pathway
    100500937 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100500937 (IGF1R)
   04140 Autophagy - animal
    100500937 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100500937 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100500937 (IGF1R)
   04520 Adherens junction
    100500937 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    100500937 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100500937 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    100500937 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    100500937 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    100500937 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    100500937 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100500937 (IGF1R)
   05202 Transcriptional misregulation in cancer
    100500937 (IGF1R)
   05205 Proteoglycans in cancer
    100500937 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100500937 (IGF1R)
   05214 Glioma
    100500937 (IGF1R)
   05218 Melanoma
    100500937 (IGF1R)
   05215 Prostate cancer
    100500937 (IGF1R)
   05224 Breast cancer
    100500937 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100500937 (IGF1R)
   01522 Endocrine resistance
    100500937 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100500937 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    100500937 (IGF1R)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100500937 (IGF1R)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   100500937 (IGF1R)
CD molecules [BR:fca04090]
 Proteins
  100500937 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476
Other DBs
NCBI-GeneID: 100500937
NCBI-ProteinID: XP_023110734
Ensembl: ENSFCAG00000018164
LinkDB
Position
B3:complement(17274637..17585197)
AA seq 1367 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTDSNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPTCPPNTYRFEGWRCVDRDFCANIPSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWGHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVTQVTNTTMSSRSRNITVADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
ESRPENSIFLKWPEPENPNGLILMYEIKYGSQIEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVPAKITYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEIENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPEDMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttttctcc
gcggcgctctcgctctggccgacgagtggagaaatctgcgggccgggcatcgatatccgt
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggcagaggactaccgcagctaccgcttccccaagctcacggtc
atcaccgagtacttgctgctgttccgtgtggccggccttgagagcctcggggacctcttc
ccgaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttt
gagatgaccaatctcaaggatattgggctttacaatctgaggaacattacccggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccacggtggactggtccctaatc
ctggatgcggtgtctaataactacatcgtgggaaacaagcccccaaaggaatgtggggac
ctgtgtccggggacgatggaggagaagcccttgtgcgagaagacgaccatcaacaatgaa
tacaactaccgctgctggacgaccaaccgctgccagaaaatgtgcccgagcgcgtgcggg
aagcgggcgtgcacggacagcaacgagtgctgtcaccccgagtgcctgggcagctgcagc
gcgccggacaacgacacggcctgcgtggcctgcaggcattactactacgccggcgtctgc
gtgcccacctgcccgcccaacacctaccgctttgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccagcgccgagagcagcgactccgaggggttcgtgatccacgac
ggcgagtgcatgcaggagtgcccctcggggttcatccggaacgggagtcagagcatgtac
tgcatcccttgtgaaggtccttgccccaaggtctgcgaggaggagaagaaaacaaagacc
attgattctgttacctctgctcaaatgctccaaggatgcaccatcttcaagggcaatctg
ctcattaatatccgccgaggcaataacattgcctcggagctggagaacttcatgggactc
atcgaggtggtgacaggctatgtgaagatccgccattcccacgccttggtctccttgtcc
ttcctcaaaaaccttcgccagatcttaggagaggagcagctggaggggaactactctttc
tatgtcctcgacaaccagaacttgcagcagctctgggactggggccaccgcaacctgacc
atcaaagctgggaagatgtactttgctttcaaccccaagttgtgcgtctccgaaatttac
cgcatggaggaggtgaccgggactaaggggcgccagagcaaaggggacatcaatacgagg
aacaacggagagcgagcctcctgtgaaagtgacgtcctgcacttcacctctacgaccacg
tggaagaaccgtatcatcataacctggcaccggtaccggccccctgactacagggacctc
atcagcttcaccgtctactacaaggaggcaccttttaaaaacgtcacggagtatgatggc
caggatgcctgtggctccaacagctggaacatggtagacgtggacctccctcccaacaag
gacgtcgagcctggcattttactgcacggactaaagccttggacgcagtatgctgtttac
gtcaaggcagtgaccctcaccatggtggagaatgaccacatccgcggggccaagagtgaa
atcttgtacattcgcaccaatgcttcagttccttccattcccctggatgttctttcggca
tcaaactcctcttctcagctcatcgtgaagtggaacccgccgtccctgcccaacggcaac
ctgagttactacatcgtgaggtggcagcggcagccccaggacagctacctttaccgccac
aactactgctccaaagacaaaatccccatcaggaagtatgccgatggcaccattgacgtc
gaggaggtgaccgagaaccccaagaccgaagtgtgtggcggagagaaggggccttgctgt
gcctgccccaaaaccgaggccgagaagcaggcggagaaggaggaggctgagtaccgcaaa
gtcttcgagaacttcctgcacaactccatctttgtgcccagacctgaaaggaagcggaga
gatgtcacacaagtcaccaacaccaccatgtccagccgaagcaggaacatcacggtggca
gacacctataatatcacagaccccgaagagctcgagacagaataccctttctttgagagc
agagtggataacaaggagagaactgtgatctctaacctccggcctttcactttgtaccgc
attgacatccacagctgtaaccacgaggctgagaagctgggctgcagcgcctccaacttt
gtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccggtgacctgg
gagtcaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatgga
ctgattctaatgtatgaaataaaatatggatcacaaatcgaggatcagcgggaatgtgta
tccagacaggagtaccggaagtatggaggcgccaagcttaaccggctcaacccggggaac
tatacggcccggatccaggccacctctctctctgggaatgggtcgtggacggatcccgtg
ttcttctacgtccccgccaaaataacatatgaaaatttcatccacctgatcatcgctctg
cctgttgccgtcctgctgatagtggggggactggttatcatgttgtacgtcttccacaga
aaaagaaataacagcaggctggggaatggagtgctgtatgcttcggtgaacccagagtac
ttcagtgccgcagatgtgtatgtacctgatgagtgggaggttgctcgggagaaaatcacc
atgagccgagagctggggcagggctcgtttgggatggtctacgaaggagttgccaaaggc
gtggttaaagatgagcccgaaaccagggtggccatcaaaacggtgaacgaggccgcgagc
atgcgtgaaaggattgaatttctcaacgaggcttcagtgatgaaggagttcaattgtcac
catgtggtgcggttgctgggcgtcgtgtcccagggccagccgacgctggtcatcatggaa
ctgatgacgcggggcgatctcaaaagttatctcaggtctctgaggccagaaatagagaat
aatccagtcctagcacctccaagcctaagcaagatgatccagatggctggagagattgca
gacggcatggcatacctcaacgccaacaagtttgtccacagggaccttgctgcccggaac
tgcatggtggctgaagatttcacggtcaaaatcggagatttcggtatgacgagagatatc
tacgagacagactattaccggaaaggagggaaggggctgctgcctgtgcgctggatgtca
cccgagtccctcaaggatggggtcttcaccactcactctgacgtctggtccttcggggtc
gttctctgggagatcgccacgctggccgagcagccgtaccagggcttgtccaacgagcaa
gtgcttcgcttcgtcatggagggcggccttctggacaagccggacaactgccccgacatg
ctgtttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaggacgagatggaacccggcttccgggaggtctccttctac
tacagcgaggagaacaagccgcccgagccggaggagctggatctggagccggaggacatg
gagagcgtccccctggacccctccgcctcctcgtcctccctgccgctgcccgacagacac
tcaggacacaaggccgagaacggcccgggccccggcgtgctggttctccgagccagcttc
gacgagagacagccttacgcgcacatgaacgggggacgcaagaacgagagggccttgcct
ctgccccagtcttcgacctgctga

DBGET integrated database retrieval system