KEGG   Felis catus (domestic cat): 100533978
Entry
100533978         CDS       T02385                                 
Symbol
CAMP
Name
(RefSeq) cathelicidin antimicrobial peptide precursor
  KO
K13916  cathelicidin antimicrobial peptide
Organism
fca  Felis catus (domestic cat)
Pathway
fca04613  Neutrophil extracellular trap formation
fca04621  NOD-like receptor signaling pathway
fca04970  Salivary secretion
fca05150  Staphylococcus aureus infection
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100533978 (CAMP)
   04621 NOD-like receptor signaling pathway
    100533978 (CAMP)
  09154 Digestive system
   04970 Salivary secretion
    100533978 (CAMP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100533978 (CAMP)
   05152 Tuberculosis
    100533978 (CAMP)
SSDB
Motif
Pfam: Cathelicidins CAP18_C Cystatin Spp-24 Ectatomin
Other DBs
NCBI-GeneID: 100533978
NCBI-ProteinID: NP_001191707
Ensembl: ENSFCAG00000008790
UniProt: F1C962
LinkDB
Position
A2:17505977..17508149
AA seq 171 aa
METQRDSPSLGRWSLLLLLLGLVITPATPQTLSYEEAVLRAVDGFNQRSSEKNLYRLLQL
DSQPEGDEDPNTPKPVSFKVKETVCPKTTQRPLEQCDFKDNGLVKQCEGTVILDRNRGYF
DINCDEILQVRKLGQLGELIQQGGQKIVEKIQKIGQRIRDFFSNLRPRQEA
NT seq 516 nt   +upstreamnt  +downstreamnt
atggagacccagagggacagcccttccttggggcggtggtcactgttgctactgctgttg
ggcctggttatcactccggccaccccccagacccttagctatgaggaagctgtgcttcgt
gctgtggatggcttcaaccagcggtcctcagagaagaatctctaccgtctccttcagctg
gactcacagcccgagggagacgaggatccaaacaccccgaagcctgtgagtttcaaagtg
aaggagactgtgtgccccaagacgacacagaggccactggagcagtgtgatttcaaggac
aatgggctggtgaagcagtgtgaagggacagtcatcctggaccggaacaggggctacttt
gacatcaactgtgatgagattctacaagtcaggaaattgggccagctgggtgagcttatc
caacaaggtgggcagaagattgttgagaagattcagaaaattggccagagaatccgtgac
ttttttagcaatcttcgccccaggcaagaggcctaa

DBGET integrated database retrieval system