KEGG   Felis catus (domestic cat): 101080392
Entry
101080392         CDS       T02385                                 
Symbol
TNFRSF1B
Name
(RefSeq) tumor necrosis factor receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101080392 (TNFRSF1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101080392 (TNFRSF1B)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101080392 (TNFRSF1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101080392 (TNFRSF1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101080392 (TNFRSF1B)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101080392 (TNFRSF1B)
   05022 Pathways of neurodegeneration - multiple diseases
    101080392 (TNFRSF1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101080392 (TNFRSF1B)
   04090 CD molecules [BR:fca04090]
    101080392 (TNFRSF1B)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101080392 (TNFRSF1B)
CD molecules [BR:fca04090]
 Proteins
  101080392 (TNFRSF1B)
SSDB
Motif
Pfam: TNFR_c6 MGC-24
Other DBs
NCBI-GeneID: 101080392
NCBI-ProteinID: XP_023113905
LinkDB
Position
C1:8949471..8982142
AA seq 463 aa
MAPAALWATLAVGLQLWAAGRAVPAQVALLPYVPEPGSSCQLTEYFDERTQMCCSKCQPG
YHAQSLCSETSNTVCARCEDSTYTKLWNWVRECLSCDSRCTSDQVETQACTPEQNRVCTC
RPGWYCTLKRQKGCRLCAPLHRCRPGFGVTRPGTATSNVACAPCGPGTFSDTTSSTDVCR
PHRICGSVAIPGNATMDAVCASVPPTLRMAPRPAPTSQPASTLSQQVEPTPGPRTAPSTS
LLFVMVPTPPAEGLSTGDISLLIGLIVAVTSLGLVIIGLVKCVIMTQKKKKPFCLQGEAK
VPHLPADKARSAPGPEQQHLLTTAPSSSSSSLESSGSTADGRAPTGTRLPAPGTEKAAGS
GEAWASSSSSEPSSGSHGTQVNVTCIVNVCSASDHGSQCASQASYTMGDVDASSSGSPND
EQVPFSKEECPFQSQPGAPETLLENPEEKPLPLGVPDAGMKPS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggcgcccgccgccctctgggccacgctggccgtcggactgcagctctgggccgcgggg
cgcgccgtgcccgcccaggttgcgttactcccctacgttccggagcctggaagctcatgc
caactgacagaatacttcgatgagaggacccagatgtgctgtagcaagtgtcagcctggc
taccatgcacagtcgctgtgctccgagacctcaaataccgtgtgtgcccgctgcgaggac
agcacctacaccaagctctggaactgggtgcgcgagtgcttgagctgtgactcccgctgc
acctctgaccaagtggagactcaggcctgcactccggaacagaaccgcgtctgcacctgc
aggccgggctggtactgcacgttgaagaggcagaaagggtgccggctgtgtgcgcccctg
cacaggtgccgcccgggcttcggcgtgaccaggccaggaactgcaacgtcaaatgtggcg
tgcgctccctgtggcccagggacgttctccgacacaacgtcgtccacagatgtctgcagg
ccccaccggatctgtggctcagtggccatccctggcaatgcaaccatggatgccgtctgc
gcatctgtgcctcctaccctgaggatggccccacgcccagcccccacgtcccagccagcg
tctacactatcccagcaagtggagccgactccaggccctcgcacggcccctagcacctcc
cttctgtttgtgatggtcccaacccccccagctgaagggctcagcacgggcgacatctct
ctcctcattggactgattgtggctgtgacatccttgggtctggtgatcatagggctggtg
aaatgtgtcattatgacccagaaaaaaaagaagcccttctgtctacaaggagaagccaaa
gtgcctcacctgcctgctgacaaggcccgaagtgcccccggccccgagcagcagcacctg
ctgaccacagcgcccagctccagcagcagctccctggagagctcaggcagcaccgcagac
gggagggcgcccaccgggacccggctgcccgcaccaggcacggagaaggccgccgggtct
ggggaggcctgggccagctccagcagctcagagccttcctctggcagccacgggacccag
gtcaacgtcacatgcatcgtgaatgtgtgcagcgcctccgaccacggctctcagtgcgcc
tcccaggccagctacacgatgggggacgtggatgccagctcctccggctccccaaatgac
gagcaggtccccttctccaaggaagaatgcccttttcagtctcagccaggggccccggag
actctgctggagaacccggaggagaagcccctgccccttggtgtgcctgatgctgggatg
aagcccagttag

DBGET integrated database retrieval system