KEGG   Felis catus (domestic cat): 101080466
Entry
101080466         CDS       T02385                                 
Symbol
RUNX3
Name
(RefSeq) runt-related transcription factor 3
  KO
K09279  runt-related transcription factor 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04658  Th1 and Th2 cell differentiation
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101080466 (RUNX3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101080466 (RUNX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101080466 (RUNX3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    101080466 (RUNX3)
SSDB
Motif
Pfam: Runt RunxI PKD_5
Other DBs
NCBI-GeneID: 101080466
NCBI-ProteinID: XP_023114084
LinkDB
Position
C1:complement(18642436..18701332)
AA seq 426 aa
MASNSIFDSFPTYSPTFIRDPSTSRRFTPPSTAFPCGGGGGGGGGKMGENSGALSAQAPV
GPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVP
DGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQ
VATYHRAIKVTVDGPREPRRHRQKLEDQTKAFPDRFGDLERLRMRVTPSAPSPRGSISTA
SHFSSQAQTPIQGTSDLNPFSDPRQFDRSFPALQTFTESRFPDPRMHYPGAMSAAFPYSA
TPSGSLSVASVPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGASSGSYQFSMV
AGSGGDRSPTRMLASCPSGASVAAGNLMNPSLGGQSDSVEADGSHSNSPTALSTPGRVDE
AVWRPY
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcttcgaacagcatcttcgattccttcccgacctactcgccaaccttcatccgcgac
ccgagcaccagccgccgcttcacacctccctccacggccttcccctgcggcggcggcggc
ggcggcggcggcggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcgcccgtg
gggcccggcgggcgcgcccggccggaggtgcgctcgatggtggacgtgctggcggaccac
gcgggcgagctcgtgcgcaccgacagccccaacttcctctgctccgtgctgccctcgcac
tggcgctgcaacaagacgctgcccgtcgcgttcaaggtggtggcgctgggggatgtgcct
gatgggacggtggtgactgtgatggcaggcaatgacgagaattactctgctgaactgcgc
aatgcctcggcagtcatgaagaaccaggtggccagattcaacgaccttcgcttcgtgggc
cgcagtgggcgagggaagagtttcacactgaccatcaccgtgttcaccaaccccacccaa
gtggccacctaccaccgagccatcaaggtgaccgtggatggaccccgggaacccagacgg
caccggcagaagctggaggaccagaccaaggcgttccccgatcgcttcggggacctggaa
cgactgcgcatgcgcgtgacgcccagcgcgcccagtccccgcggttccatcagcaccgcc
agccacttcagcagccaggcccagacccccatccaaggcacctcggacctgaaccctttc
tccgacccccgccagttcgaccgctccttcccggcgctgcagaccttcaccgagagccgc
ttccccgaccccaggatgcattacccgggggccatgtcggccgccttcccctacagcgcc
acaccctcgggcagcctcagcgtggccagcgtgccggccaccagccgcttccaccacacc
tacctcccgccgccctacccgggggccccgcagaaccagagcgggcctttccaggccaac
ccgtccccctaccacctctactacggcgcgtcctcgggctcctaccagttctccatggtg
gccggcagcgggggcgaccgctcccccacccgcatgctggcctcctgccccagcggcgcc
tccgtcgccgccggcaacctcatgaaccccagcctgggcggccagagcgacagcgtggag
gcggacggcagccacagcaactcccccaccgccctgagcacgccgggccgcgtggacgag
gccgtgtggcggccctactga

DBGET integrated database retrieval system