KEGG   Felis catus (domestic cat): 101080562
Entry
101080562         CDS       T02385                                 
Symbol
STAM2
Name
(RefSeq) signal transducing adapter molecule 2 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101080562 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101080562 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101080562 (STAM2)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101080562 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH SH3_10
Other DBs
NCBI-GeneID: 101080562
NCBI-ProteinID: XP_003990813
Ensembl: ENSFCAG00000025382
UniProt: M3WQ89
LinkDB
Position
C1:complement(145120802..145173387)
AA seq 525 aa
MSLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGTGLFPSNFVTTNLNIESEAAAVDKLNVIDEEEEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNRLVNEAPVYPVYSKLHPPAHYPPSSAGVPMQTYPVQSHGGNYMGQSLHQVTVAQSYSL
GPDQIGPLRSLPPNVNSSVTTQPAQTPYLSAGQDTVSNPTYMNQNSNLQSAAGTAAYTQQ
MGMSVDMSSYRNATSNLPQLAGFPVAAPAHSVAQQQTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgtctctgttcactgcaaaccccttcgagcaagacgtggaaaaagccacaaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttgggagcactcct
aatggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaggttcctcat
gttgctctgcaggcgttaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtgtgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggatcctcagtttagtctaatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccagcaggttctcagactgtctcagctgctgccaagaatggtacatca
tcgaacaaaaacaaagaagatgaagacatagctaaagctattgaattatcattacaagag
cagaagcagcagcacacagaaacgaaatccttatatccatctgcagaaattcagttaaat
aataaagttgcaaggaaagtgagagctttatacgattttgaagccgttgaggacaatgaa
cttacttttaaacacggtgaaattattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaacaggactcttcccatctaattttgtaacaactaattta
aacatagagtctgaggcagcagctgtggacaaattgaatgtaattgatgaggaggaggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtactccagagtatagatccaacagattcaaaaccagactcccaagacctcttg
gatttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagagatt
gatcggaagcattcagaattgtctgaattgaatgtaaaagtcttggaagccctggaacta
tataacaggttggtgaatgaagcaccagtatatccagtctattcaaagctccatcctcca
gcacattacccaccttcatcagctggggttccaatgcagacatacccagttcaatcgcat
ggtggaaactatatgggtcaaagccttcaccaagtcactgtggcccaaagctacagccta
ggaccagatcagattggtccactgagatctctgcctccaaatgtaaattcctcagtgaca
acacagcctgcacagactccatatttaagcgctggacaagacactgtttccaaccctact
tacatgaaccagaactctaaccttcaatcagctgctggtacagctgcttacacgcagcag
atggggatgtctgtggatatgtcatcgtaccggaacgctacttccaatttgccgcaactg
gcaggctttccggtggcggctcccgctcattcagttgcacagcagcaaacaaattaccat
cagcagcctcttctttag

KEGG   Felis catus (domestic cat): 101092504
Entry
101092504         CDS       T02385                                 
Symbol
STAM
Name
(RefSeq) signal transducing adapter molecule 1
  KO
K04705  signal transducing adaptor molecule
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101092504 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101092504 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092504 (STAM)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    101092504 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 101092504
NCBI-ProteinID: XP_004001160
Ensembl: ENSFCAG00000024059
UniProt: M3XDT7
LinkDB
Position
B4:16540737..16622342
AA seq 538 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEQA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSGSQVYPGPPQSGAYLVAGSA
QMSHLRSYSLPPEQLSSLSQGAVPPSVNAALPSQQTQASYPNTMVSSVQGNTYPNQASVY
SPPPAAAAATADVTIYQNAGTNMSQVPNYNLTSSSLPQPGGSQQPPQPQQPYSQKALL
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaatcccttcgatcaggatgttgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcattttggatatttgtgacaaagtcggtcagtctcgc
actggacctaaagattgtcttcggtctattatgagaagggtgaaccataaagatcctcat
gttgctatgcaggctctgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgccagtgaagtaagcaacgtattaaacaagggt
catcctaaagtctgtgaaaaattaaaggctcttatggtcgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggagcaaggagtt
acatttccagctattggctctcaggctgcagaacaagcaaaagcaagcccagccctggtt
gccaaagaccctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagctatt
gagttgtccttgaaggagcaaaggcagcagtcaaccacactttctactttgtacccaagc
acatccaatctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagataatgagcttacttttaaagccggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatggggttatttccc
tctaattttgtgactgctgatcttactgctgaaccagaaatgattaaaacggagaagaag
acggtacaatttagtgatgatgttcaggtagaaacaatagagccagaaccggaacaagcc
tttattgatgaagacaaaatggaccagttgctacagatgttgcagagtacagatcccagt
gatgaccaaccagatcttccagagttacttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aatgttaaagtgatggaagcactttcattgtataccaagttaatgaatgaagatccaatg
tattccatgtatgcaaaattacagaatcagcagtattatatgcagtcatctggtgtttct
ggttctcaggtgtacccagggcctcctcagagtggtgcttacctggttgcagggagtgca
cagatgagccatctcaggagctacagtcttcccccagagcagctgtcttctctcagccaa
ggagctgttccgccatctgtaaacgcagcccttcccagtcagcagactcaggcttcttac
cctaacacaatggtcagttctgttcaaggaaatacataccccaaccaggcttcagtatat
agtcctcctcctgccgctgctgctgctactgccgatgtcactatataccagaacgcagga
actaatatgtcccaggtgccaaactataatttaacatcatcatcgttgcctcaacccgga
ggcagtcaacagccacctcagccacagcaaccatattctcagaaggctctgctatag

DBGET integrated database retrieval system