KEGG   Felis catus (domestic cat): 101080604
Entry
101080604         CDS       T02385                                 
Symbol
CD247
Name
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform X1
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
fca  Felis catus (domestic cat)
Pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080604 (CD247)
   04660 T cell receptor signaling pathway
    101080604 (CD247)
   04658 Th1 and Th2 cell differentiation
    101080604 (CD247)
   04659 Th17 cell differentiation
    101080604 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101080604 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101080604 (CD247)
   05169 Epstein-Barr virus infection
    101080604 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101080604 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080604 (CD247)
   04090 CD molecules [BR:fca04090]
    101080604 (CD247)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101080604 (CD247)
CD molecules [BR:fca04090]
 Proteins
  101080604 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 101080604
NCBI-ProteinID: XP_023103509
LinkDB
Position
F1:complement(12247822..12322147)
AA seq 183 aa
MAATASASWCHPGGKDKGMWKVLVIMALLQAQLPGTEAQSFGLLDPKLCYLVDGILFIYG
VIITALFLRAKFGRSAAAPASQQGANQLYNELNLGGRQEYEVLDKRRGLDPEMGGKQQRR
RNPPEVVYNALQKDKMAEAYSEIGIKGDNQRRRGKGHDGLYQGLSTATKDTYDALHMQTL
PPR
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcggccacagcctcggcctcctggtgccaccctgggggaaaggacaaggggatgtgg
aaggtgcttgtcatcatggccctgctgcaggcacagctcccaggaacagaggcgcagagt
tttggcctgctggatcccaaactgtgctacctggtggacggaatccttttcatctatggc
gtcattatcactgccctgttcctgagagcaaagttcggcaggagcgcggccgcccccgcg
agccagcagggcgccaaccagctctacaacgagctcaatctgggaggaagacaggagtac
gaagttttggataagagacgaggcctggaccctgagatgggaggaaaacagcagaggagg
aggaatcctccggaagtcgtgtacaatgcactgcaaaaagacaagatggcggaggcctac
agtgagattgggataaaaggcgacaaccagcggcggagagggaaggggcatgatggcctc
taccaggggctcagcacggccaccaaggacacctatgacgccctccacatgcagaccctg
ccccctcgctaa

DBGET integrated database retrieval system