KEGG   Felis catus (domestic cat): 101080871
Entry
101080871         CDS       T02385                                 
Symbol
MSN
Name
(RefSeq) moesin
  KO
K05763  moesin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04530  Tight junction
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05162  Measles
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101080871 (MSN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101080871 (MSN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101080871 (MSN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101080871 (MSN)
  09172 Infectious disease: viral
   05162 Measles
    101080871 (MSN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101080871 (MSN)
   04147 Exosome [BR:fca04147]
    101080871 (MSN)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     101080871 (MSN)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101080871 (MSN)
SSDB
Motif
Pfam: ERM_C ERM_helical FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 101080871
NCBI-ProteinID: XP_004000620
Ensembl: ENSFCAG00000013821
UniProt: M3WJI8
LinkDB
Position
X:55364926..55430132
AA seq 577 aa
MPKTINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKSFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERALLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQHELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASQDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcctaagacgatcaatgtgcgtgtgaccaccatggatgcagagctggagtttgctatc
cagcccaacaccactgggaaacagctgtttgatcaagtggtaaaaactattggcctgagg
gaagtttggttctttggtctgcagtaccaggacactaaaagtttctctacttggctcaaa
ctcaataaaaaggtgactgcccaggatgtgcggaaggaaagccctctactcttcaagttc
cgagctaagttctaccctgaggatgtatctgaggaattgatccaggacatcacccagcgc
ctgttcttcctgcaagtgaaggagggcattctcaatgatgatatttactgcccacctgag
actgctgtgctgctggcctcctatgctgtccagtctaaatatggtgacttcaataaggaa
gtccacaagtctggctacttggctggggacaagttgctgccacagagggtcctggagcag
cataaactcaacaaggaccagtgggaggagcggatccaggtgtggcatgaggagcaccgg
ggcatgcttagggaagatgctgtcctagagtatctgaagattgcccaggacctggagatg
tatggtgtgaactacttcagcatcaagaacaagaaaggctcagagctgtggctgggggtg
gatgctctaggtctcaacatctatgagcagaatgacagactgactcccaagataggcttt
ccctggagtgaaatcagaaacatttctttcaatgacaagaaatttgtcatcaagcccatt
gacaaaaaagccccggactttgtcttttatgctccccggctgcggattaacaagcgtatc
ttggccttgtgcatggggaaccatgaactatacatgcgccgccgcaagcctgacaccatt
gaggtgcagcagatgaaggcacaggcccgggaggaaaagcaccagaaacagatggaacgt
gctctgctggaaaatgagaagaagaagcgtgagatggcagaaaaggagaaggagaagatc
gaacgggaaaaggaggaactgatggagagactgaagcagattgaggaacagactaagaag
gctcagcatgaactggaagaacagacccgcagggctctggagcttgagcaggagcggaag
cgtgcccagagtgaggctgaaaaactagccaaagaacgtcaagaagctgaagaagccaag
gaagccctgttgcaggcctctcaggatcagaagaagacccaggaacagctggccttggaa
atggcagagttgacagctcgaatctcccagctggagatggcccgacagaagaaggaaagt
gaagctgtggaatggcagcagaaggctcagatggtacaagaagatttggagaagacccgt
gctgagttgaagactgctatgagtacacctcatgtagccgagcctgctgagaatgagcag
gatgagcaggatgagaatggggcagaggccagtgctgacctgcgggctgatgccatggcc
aaagaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
catctgaaggccctcacttcagaactggccaatgcccgcgatgagtccaagaagactgcc
aatgacatgatacatgctgagaacatgcgacttggccgagacaaatacaagactttgcgt
cagatccggcagggcaataccaagcagcgcatcgatgaatttgagtcgatgtaa

DBGET integrated database retrieval system