KEGG   Felis catus (domestic cat): 101080922
Entry
101080922         CDS       T02385                                 
Symbol
PXN
Name
(RefSeq) paxillin isoform X2
  KO
K05760  paxillin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101080922 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101080922 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101080922 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101080922 (PXN)
   04062 Chemokine signaling pathway
    101080922 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101080922 (PXN)
   05203 Viral carcinogenesis
    101080922 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101080922 (PXN)
   05163 Human cytomegalovirus infection
    101080922 (PXN)
   05165 Human papillomavirus infection
    101080922 (PXN)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101080922 (PXN)
   05100 Bacterial invasion of epithelial cells
    101080922 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101080922 (PXN)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 LIM domain-containing proteins
  Paxillin family proteins
   101080922 (PXN)
SSDB
Motif
Pfam: LIM Paxillin
Other DBs
NCBI-GeneID: 101080922
NCBI-ProteinID: XP_011286092
LinkDB
Position
D3:complement(16590020..16637355)
AA seq 751 aa
MSSSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPHCGIPENNSPLGGK
AGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEVSSPQRATSSQQ
QTRMSASSATRELDELMASLSDFKAIFPDTWSLTKECGQRKQRAKPEPGELESSGPAPVG
KEQLGGQTLMKGSLVRPTQGPETPRWPEGVTEAAARREQSELPPAVVTDTPSTTERISTS
GQIRSVIRRSRETGHAHPMSREPSPRRRLDPATLSRTPSQERLIAELQGRLGIQPEAEEA
AGAAGASAEDWLTEGVIITVQPRGRRAGGQLVEKVVFPPGSPVPLRRTFSVLASPPPVPL
LQQRKDSSASSPSPPPSLPAPSSLGPSALARGSPGDLSAVAGLQEEGVKGPTPPPPVPQT
WRSVGCQTDEDPLFPPMQIQGLEQIADGEAWAAGWPPNGRQSSPEGQDEGGFMAQGKTGS
SSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPE
HFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEH
FFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECF
VCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFV
CAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgagctcctccctgggcagcaacctttctgaacttgaccgcctgctgctggaactgaac
gctgtgcagcataaccccccaggcttccctgcagatgaggccaactccagccccccactg
cctggggctctgagcccccactgtggcatcccggagaataacagcccattggggggcaaa
gctgggcccctgaccaaagagaagcccaagcggaatgggggccgtggtctggaggacgtg
cggcccagtgtggagagtctcttggatgaactggagagctctgtgcccagcccagtccct
gccatcactgtgaaccagggcgaggtgagcagccctcagagagccacctccagccagcag
cagacacgcatgtcggcctcctctgccaccagggagctggacgagctgatggcctcgctg
tcggatttcaaggccatcttcccagatacctggagtctcaccaaggaatgtggacagcgg
aagcagagggcaaagccagagccaggggagctggaaagcagcggcccggccccagttggc
aaggagcagttaggtggacagacactcatgaagggaagcctggtcaggccaacccaggga
cctgagacccccaggtggccagagggcgtcactgaagctgctgccaggagggaacagtcg
gagcttccacctgccgtggtcacggacacgcccagcaccactgagaggatttccacctcg
ggccagatccgctctgtgatcaggaggagccgggagacgggccacgcgcaccccatgtcc
cgggagccctcccctcgccgccggctggaccccgccaccctgagcaggaccccatcccag
gagcggctcatcgcagagctgcagggtcggctcggcatccagccggaggcagaggaggca
gcgggggcagcgggggcctctgctgaggactggctgactgagggcgtcatcatcactgtg
cagcctcgagggaggcgggctggggggcagcttgtagagaaggtcgtcttccctcctggc
tcccctgttcccctgagaagaaccttctctgttctggcttctcctcctcctgtccctttg
ctccagcagcgtaaagactcctcagccagcagcccttctcccccacccagcctgcccgcc
ccctcctccctggggccctccgctcttgcccgaggttcccctggggacttgagtgctgtg
gcagggctgcaggaggagggtgtgaagggccccacccctccccctcctgtaccccaaact
tggaggtccgtgggctgccagaccgacgaggacccgctcttccccccgatgcagatccag
ggcctggaacagattgcggatggagaagcatgggcggccggctggcctccgaacggcagg
cagagcagtcccgaagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctctccccctggggggcctccaaagcctggaagccagctggatagtatgctggggagc
ctgcagtctgacctgaacaaactgggggtcgccacggttgccaaaggggtctgcggggcc
tgcaagaagcccattgccgggcaggttgtgaccgccatgggaaagacgtggcacccggag
cactttgtctgcacccactgccaagaggagatcggatcccggaacttctttgagcgggac
gggcagccctactgtgaaaaggactatcacaacctcttctccccacgctgctactactgc
aacggtcccatcctggataaagtggtgacagccctggaccggacgtggcaccccgagcac
ttcttctgcgcccagtgtggagccttctttggtcccgaagggttccatgagaaagacggc
aaggcctactgccggaaggattacttcgacatgttcgcgcccaagtgtggcggctgtgcc
cgggccatcctggagaactacatctcggccctcaacactctctggcatcccgagtgcttt
gtgtgccgggagtgcttcacgcccttcgtcaacggcagcttcttcgagcacgatgggcag
ccctactgtgaggtgcactaccacgagcggcgaggctcactgtgctctggctgccagaag
cccatcacgggccgctgcatcaccgccatggccaagaagttccatccggagcacttcgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system