KEGG   Felis catus (domestic cat): 101081146
Entry
101081146         CDS       T02385                                 
Symbol
LTBR
Name
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor receptor superfamily member 3
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04672  Intestinal immune network for IgA production
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101081146 (LTBR)
   04066 HIF-1 signaling pathway
    101081146 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081146 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081146 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101081146 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101081146 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101081146 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101081146 (LTBR)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101081146 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101081146
NCBI-ProteinID: XP_003988366
Ensembl: ENSFCAG00000008592
LinkDB
Position
B4:41488831..41495977
AA seq 466 aa
MRLPWAASPCGLAWGPLVLGLCSLLAASQAPLMREGPAQAPPYHTENQTCQDREKEYYEP
KHRVCCSRCPPGTRVSVECSRGQNTVCAMCPENSYNEHWNHLSFCQMCRPCDQMLGFEET
VPCTSKQKTQCRCQPGMFCVHWDTECVHCEPLSNCPPGTEVELKDEVSEAKRNCVPCKAG
HFQNTSSPRARCQPHTRCEEQGLVEAVPGTAQSDTSCRNPLESPEMPGTVLVLAILLPLA
SLLFLTTVLACSWKSHPSLCRKLGSLLKRRPEGEESNTADGSWEPPRVNPHFPDLVKPLL
PFSGDLAPASARLPATPGLEEEVLQQQSPLSQARELEAELPEQGQVAHGTNGIHVTGGSV
TVTGNIYIYNGPVLGGARGPGDPPAPPEPPYPTPEEGAPGPPGLSTPYQEDGKAWHLAET
EHWGAMPSNXGPRTQFVPHASWCLGKARRREVQEHLLPAAALPTQD
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgcgcctgccgtgggccgcctccccctgcggcctggcctgggggccactcgtcctgggc
ctctgcagtctcctggcagcatcccaggccccactgatgagggaggggcccgcacaggcg
cccccataccacacggagaaccaaacgtgccaggaccgggaaaaggagtactacgagccc
aagcatcgggtctgctgctcccgctgccccccaggcacacgtgtctcagtggaatgcagc
cgcggccagaacacagtgtgtgccatgtgccccgagaattcctacaacgagcactggaac
catctttccttctgccagatgtgccgcccctgtgaccagatgctgggcttcgaggagact
gtgccttgcaccagcaaacagaaaacccagtgccgctgccagcccggaatgttctgcgtg
cactgggacaccgagtgtgtgcactgcgagccactctccaactgcccacctggcactgag
gtggagctcaaagatgaagtctcggaggctaagagaaactgtgttccctgtaaggcaggg
cacttccagaatacctcctcccccagggcccgctgccagccccacacgaggtgtgaggaa
cagggtctggtagaggcagttccaggcactgcccagtctgacaccagctgcagaaatcca
ctcgagtcccctgagatgccaggaaccgtgctggtgctggccatcctgctgccgctggcc
tctctcctgttcctcaccacggtcctggcctgctcctggaagagccacccctctctctgc
aggaagctgggatccctgctcaagaggcgtccagagggagaggaatcaaatactgctgat
ggaagttgggaacctccaagggtcaacccacatttccctgacctggtaaagccacttctg
cccttctctggagacttggccccggcctcggccaggctcccagcgaccccaggcttggag
gaagaggtgctacagcagcagagtcctctaagccaggccagggagctggaggctgagctc
ccagagcaaggccaggtggcccatggtaccaacggcattcatgtcaccggcgggtctgtg
actgtcactggcaacatctacatctacaacgggccagtactggggggagcacggggccct
ggagacccccctgctcccccagaacctccataccccacccctgaagagggtgccccaggc
ccccccgggctctctacaccctaccaggaggatggcaaagcttggcacctggctgaaaca
gagcactggggtgccatgccctctaacnnagggccaaggacccaatttgtcccccatgcc
tcttggtgtctgggaaaagccaggagaagggaggtgcaagagcatcttctccctgcggct
gccctacccacacaggactga

DBGET integrated database retrieval system