KEGG   Felis catus (domestic cat): 101081159
Entry
101081159         CDS       T02385                                 
Symbol
IL20RB
Name
(RefSeq) interleukin-20 receptor subunit beta isoform X1
  KO
K05137  interleukin 20 receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101081159 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081159 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081159 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101081159 (IL20RB)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101081159 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 101081159
NCBI-ProteinID: XP_006936443
Ensembl: ENSFCAG00000001804
UniProt: M3VXB1
LinkDB
Position
C2:complement(128431121..128465327)
AA seq 294 aa
MWFFYTLIPCLLIDGVAILPAPQNLSVQSTNMKHLLMWSPVTVPGEIIYYFVEYQGEYES
LYMSHVWIPSSWCSPTKGPECDITDDITATVPYNLRVRATQGSETSAWSTLKPPFNRNST
ILTPPGMDVTKDGFHLVIKLEDLGSQFEFLVAYWRREPGAKEHVKVVRSRGIPVHLETME
PGAAYCVKVQTFVKAIGRHSPFSQTECVKVQGETLPLALALFGFVGFMLILVVVPLSIWK
MGRLLRHSCCPVVVLPDTLKITNSPQKLISCRREEVEACATAMLSSEEPFRTWI
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtggtttttctacaccttgattccatgtttgctcattgatggagtggccatcctgcct
gcccctcagaacctctctgtacaatcaaccaacatgaagcatctcttgatgtggagccca
gtgacggtgcctggagaaataatatactatttcgtcgagtaccagggagagtacgagagc
ctgtacatgagccacgtctggatccccagcagctggtgctcacccaccaaaggtcctgag
tgtgacatcactgatgacatcactgccactgtgccatacaatctccgtgtcagggccacc
cagggctcagagacctcagcctggagcactctgaagcctcccttcaatcgaaattcaacc
atccttaccccgcctgggatggatgtcaccaaggacggcttccatctggttattaagctg
gaagacctggggtcccagtttgagttccttgtggcttactggaggagggagcctggtgcc
aaggaacatgtcaaagtggtgaggagcaggggcattccggtgcacctggaaaccatggaa
ccaggggctgcatactgtgtgaaggtccagacattcgtgaaggccatcgggagacacagc
cctttcagccagacagaatgtgtcaaggtgcaaggagagaccctccccctggcgctggcc
ctgtttgggtttgttggcttcatgctgatcctcgtggttgtgcccctttccatctggaaa
atgggccggctgctccggcactcctgttgtcccgtggtggtgcttcccgacaccttgaaa
ataaccaattcaccccagaagttaatcagctgcaggagggaagaggtggaagcctgtgcc
actgctatgctgtcttcggaggaacccttcaggacctggatctag

DBGET integrated database retrieval system