KEGG   Felis catus (domestic cat): 101081290
Entry
101081290         CDS       T02385                                 
Symbol
MSR1
Name
(RefSeq) macrophage scavenger receptor types I and II isoform X1
  KO
K06558  macrophage scavenger receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101081290 (MSR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081290 (MSR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101081290 (MSR1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101081290 (MSR1)
CD molecules [BR:fca04090]
 Proteins
  101081290 (MSR1)
SSDB
Motif
Pfam: Macscav_rec SRCR Collagen SRCR_2 DUF4446 UPF0449
Other DBs
NCBI-GeneID: 101081290
NCBI-ProteinID: XP_023108178
Ensembl: ENSFCAG00000006956
LinkDB
Position
B1:22468694..22554520
AA seq 454 aa
MEPWDRFPDHQDDADSCSESVKFDARSMTALLPLNPKNGPTLQEKLKSLKAALIALYLLV
FVVLVPIIGIMAAQVLKWEMKNCTVGSINANDMSQSLAGKANDSEEEMRFREAVMEQMNN
MEKRIQFISDTEANLIDSEHFQNFSLVTDQRFNDVLLQLSTLVSSVQGHGNAIDEISKSL
ISLNITLLDLQLNIQTLNGKVQENTFKHQEDMSRLEERVYNASAEIMSMKEKQVNLEQEI
KGEVKLLNNITNDLRLKDWEHSQTLKNITLIQGPPGRPGEKGDRGPAGESGPRGIPGAIG
PPGPKGDRGAIGFPGSRGFPGPMGKTGRTGNPGPKGQKGEKGSGSMLTPPKTVRLVGGSG
PHEGRVEIFHSGHWGTVCDDHWELRGGQVVCRSLGYQGVQAVHKGAYFGQGTGPIWLNEV
FCFGRESSIEECKIKQWGARVCSHSEDAGVTCVL
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggaaccgtgggataggtttcctgatcaccaggatgatgctgatagctgctcagaatct
gtgaagttcgacgcccgctccatgacagccttgcttcctctgaatcctaaaaatggtcct
acccttcaagagaaactgaagtctctcaaagctgcactgattgccctttatctccttgtg
tttgtagttctcgtgcctatcatcggaataatggcagcgcaagtcctgaagtgggaaatg
aagaattgcacagttggttcaattaatgcaaacgatatgtctcaaagtctcgcaggaaaa
gcaaatgacagtgaagaagaaatgagatttcgagaagctgtaatggaacaaatgaacaac
atggagaagagaatccaatttatttcagatacagaagccaatctcatagattcagagcat
ttccaaaattttagtctggtgactgatcaaagattcaatgatgttcttctccagctgagc
accttggtttcctcagttcagggacatggaaacgcaatagatgaaatctccaagtcgtta
atcagtctgaatatcacattgcttgacttgcagctcaatattcaaacactgaatggcaaa
gtccaagagaatacatttaaacatcaagaggacatgagtagattagaggagcgtgtgtat
aatgcatcagcagaaattatgtctatgaaagaaaaacaagtgaatttggaacaggaaata
aaaggagaagtgaaactactgaataatatcactaatgatctcagactgaaagattgggaa
cactctcagacgttgaaaaatatcactttaattcaaggtcctcctggacgcccaggtgaa
aaaggagataggggtcctgctggagaaagtggtccacgaggcattccaggtgcaataggt
cctccaggtcccaaaggtgatcggggagcaattggctttcctggaagccgaggattccca
ggaccaatggggaagaccgggaggacaggaaatcctggacccaaaggccagaagggggaa
aaagggagcggaagcatgctaactccacctaagaccgtacgattggttggtggtagcggt
cctcatgagggcagagtggagattttccacagtggccactggggcacggtctgtgatgac
cactgggagctacgaggtggacaggtcgtctgtagaagtttgggttaccaaggtgttcaa
gctgtgcataagggagcttactttggacaaggtaccggtccaatctggctgaatgaagtg
ttttgttttgggagagaatcatctatcgaagaatgtaaaattaaacagtggggtgcgaga
gtctgttcacactctgaagatgctggagtcacttgcgttttataa

DBGET integrated database retrieval system