Felis catus (domestic cat): 101081453 Help Entry 101081453         CDS       T02385                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism fca  Felis catus (domestic cat) Pathway fca04144   Endocytosis fca04510   Focal adhesion fca05020   Prion disease fca05100   Bacterial invasion of epithelial cells fca05205   Proteoglycans in cancer fca05410   Hypertrophic cardiomyopathy fca05412   Arrhythmogenic right ventricular cardiomyopathy fca05414   Dilated cardiomyopathy fca05416   Viral myocarditis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101081453 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101081453 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     101081453 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     101081453 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     101081453 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101081453 (CAV3)    05410 Hypertrophic cardiomyopathy     101081453 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     101081453 (CAV3)    05414 Dilated cardiomyopathy     101081453 (CAV3)    05416 Viral myocarditis     101081453 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101081453 (CAV3) Membrane trafficking [BR:fca04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     101081453 (CAV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  101081453 NCBI-ProteinID:  XP_003982494 LinkDB All DBs Position A2:50184422..50197200 Genome browser AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQICSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaagagcacacagacctggaggcccagattgtcaaggacatccactgcaag gagatcgacctggtgaaccgagaccccaagaacattaacgaggacatagtgaaggtggat tttgaagacgtgatcgcggagcccgtgggcacctacagcttcgacggagtgtggaaggtg agctacaccaccttcactgtctccaagtactggtgctaccgcctgctgtccacgctgctg ggagtccctctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccgtgcatcaagagctacctgatcgagatccagtgcatcagccacatc tactccctctgcatccgtaccttctgcaacccgctctttgccgccctgggccagatctgc agcaacatcaaggtgatgctgcggaaggaagtatga

DBGET integrated database retrieval system