KEGG   Felis catus (domestic cat): 101081548
Entry
101081548         CDS       T02385                                 
Symbol
FOXO3
Name
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04062  Chemokine signaling pathway
fca04068  FoxO signaling pathway
fca04137  Mitophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04722  Neurotrophin signaling pathway
fca04917  Prolactin signaling pathway
fca04936  Alcoholic liver disease
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05213  Endometrial cancer
fca05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101081548 (FOXO3)
   04151 PI3K-Akt signaling pathway
    101081548 (FOXO3)
   04152 AMPK signaling pathway
    101081548 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101081548 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    101081548 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101081548 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101081548 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101081548 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    101081548 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    101081548 (FOXO3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101081548 (FOXO3)
  09162 Cancer: specific types
   05213 Endometrial cancer
    101081548 (FOXO3)
   05223 Non-small cell lung cancer
    101081548 (FOXO3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101081548 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101081548 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101081548 (FOXO3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    101081548 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 101081548
NCBI-ProteinID: XP_003986502
LinkDB
Position
B2:100578829..100705414
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGETAADSMIPEE
EDDEDDEDGSGRASSAMAIGGGGSGTLGSGLLLEDSARLLAPGGQDSGSGPALAAGALSG
GTQTPLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLSDNLMDDLLDNITLPSSQPSPTGGLMQRSSSFPYTAKGS
GLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSVKHQQQSPVSQSMQTLSDSLSGSSLYSASANLPV
VGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccggcctccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccagagctc
caggggagcccggccaagccctcgggggagacggccgccgattccatgatccccgaagag
gaggacgatgaagacgacgaggacggtagcggtagggccagctcggccatggcgatcggc
ggcggcgggagcggcacgctgggctccgggctgctccttgaagactcggcccggctgctg
gctcctggagggcaggactccgggtccgggccagccctcgcggcgggcgcgctgagcggg
gggacgcagacgccgctgcagcctcagcagccactgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgctcgtcgcggcggaacgcctggggaaacctgtcc
tacgccgacctgatcactcgcgccatcgagagctccccggacaaacggctcactctgtcc
cagatctacgagtggatggtgcgctgcgtgccctacttcaaggataagggcgatagcaac
agctcggccgggtggaagaactctattcggcacaacctgtcactgcacagccgtttcatg
cgggtccagaatgaggggactggcaagagctcttggtggatcatcaaccctgatgggggg
aagagcgggaaggcaccccggcggcgggctgtctccatggacaacagcaacaagtatacc
aagagtcgtggccgtgcagccaagaagaaggcagccctgcagacagcccccgagtcagca
gatgacagtccgtcccagctctctaagtggcctggcagccccacgtcacgcagcagtgat
gagctggatgcgtggaccgacttccgctcacgcaccaattccaatgccagcacggtcagt
ggccgcctgtcacccatcttggcaagcacggagttggatgacgtccaggatgatgatgca
ccgctctcccccatgctctacagcagctcagctagcctgtcaccctctgtaagtaagcca
tgcaccgtggaactaccacgtttgaccgacatggcgggcaccatgaatctgaatgatggg
ctctctgacaacctcatggatgacctgctggataacatcacactcccatcgtcccagcca
tcgcccaccggagggctcatgcagcggagctctagcttcccatacaccgccaagggctcc
ggcctgggctctccaaccagctccttcaatagcacggtgtttggaccctcgtctctgaat
tccctgcgccagtctcccatgcagaccatccaagagaacaagccagctaccttctcttcc
atgtcacactatggcaaccagacactccaggacctgctcacttcagactcactcagccac
agcgatgtcatgatgacccagtcagaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaactcccgccggaacgtgatgcttcgaaatgacccaatgatgtcctttgctgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagcgac
tccagcagccttgggtcagtcaaacaccagcagcaatctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcagctagtgcaaaccttcccgtc
gtgggccacgagaagttccccagcgacttggacctggacatgttcaatgggagcttggag
tgcgacatggagtccattatccgtagtgaactcatggatgccgatgggttggattttaat
tttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system