KEGG   Felis catus (domestic cat): 101081599
Entry
101081599         CDS       T02385                                 
Name
(RefSeq) cytokine SCM-1 beta
  KO
K22675  C motif chemokine 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081599
   04061 Viral protein interaction with cytokine and cytokine receptor
    101081599
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101081599
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101081599
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101081599
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101081599
NCBI-ProteinID: XP_023103368
Ensembl: ENSFCAG00000029190
LinkDB
Position
F1:13210012..13213171
AA seq 112 aa
MRPLVLALLAICFLTEFMAEGVGSEVLERSICVSLTTKKLPVKNIKTYTIKEGSMKAVIF
ITRRGLKVCADPQAEWVKKAVENVDKSTRRNMKQTKPTGAQHLTNSAVTLTT
NT seq 339 nt   +upstreamnt  +downstreamnt
atgagacctctcgtcctggccctgctcgccatctgctttctcaccgaattcatggcagaa
ggcgtggggagtgaagttctagaaaggagcatctgcgtgagcctgacgaccaagaaactg
ccagttaaaaacatcaagacctacaccatcaaggagggctccatgaaagcagtaatattc
attaccagacgtggcctcaaggtctgtgcggatccacaagccgagtgggtgaaaaaggca
gtagaaaacgtggacaagtccaccagaagaaacatgaaacagaccaagccaacaggagcc
caacatctcaccaattcagctgtgaccctgaccacatag

DBGET integrated database retrieval system