KEGG   Felis catus (domestic cat): 101081746
Entry
101081746         CDS       T02385                                 
Symbol
FN1
Name
(RefSeq) fibronectin isoform X1
  KO
K05717  fibronectin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04810  Regulation of actin cytoskeleton
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101081746 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101081746 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081746 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101081746 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081746 (FN1)
   05205 Proteoglycans in cancer
    101081746 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101081746 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101081746 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101081746 (FN1)
   05100 Bacterial invasion of epithelial cells
    101081746 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101081746 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101081746 (FN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081746 (FN1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081746 (FN1)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101081746 (FN1)
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101081746 (FN1)
Membrane trafficking [BR:fca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    101081746 (FN1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   101081746 (FN1)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101081746 (FN1)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   101081746 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 NDNF
Other DBs
NCBI-GeneID: 101081746
NCBI-ProteinID: XP_003991167
Ensembl: ENSFCAG00000009217
UniProt: M3WB06
LinkDB
Position
C1:complement(200893554..200963182)
AA seq 2475 aa
MLRGPGPRLLLLAVLSLGTAVPSTGASKSKRQAQQIIQPQTPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHAALQTTSAGSGSFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTENYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHISKYILRWKPKNSPRGWKEATIP
GHLNSYTIKGLTPGVVYEGQLISVQHYGHREVTRFDFTTTSTSTAVTSNTVTGETTPLSP
VVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVSIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPAVDRVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTG
VPRSDKVPPPKDLQFVEVTDVKITIMWTPPQSPVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYHFKVFAVNQGRESKPLTAEQTTKLDAPTNLRFTNETDSTVIVTWTPP
RARIAGYRLTVALTRGGQPKQYNIGPSASQYPLRNLQPASEYTATLMAVKGNQQSPKATG
VFTTRQPLGSVPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSESGSIVV
SGLTPGVEYIYTISVLRDGQERDTPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESAPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITAHSFTVHWIAPRATITGYRIRHHPEHTGGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPPLIGQQSTVSDVPRDLEVIAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGADYTITVYAVTGRGDSPA
SSKPISIDYRTEIDKPAQMQVTDVQENSISVRWLPSSSPVTGYRVTTTPKNGPGPSKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSNPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDSLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAIPANGQTPIQRTIKPDVRSYTITGLQPGMDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFINPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPVR
HRPRPYPPNVNEEIQVGHVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQESS
EYIISCHPVGIDEEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDHKRHKVREEVVTV
GNSVDQGLNQPTGDSCFDPYTVSHHAVGEEWERLSESGFKLSCQCLGFGSGHFRCDSSKW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGAEPGHEGSTGHYNQYSQRYHQRTNTNVNCPIEC
FMPLDVQADREDSRE
NT seq 7428 nt   +upstreamnt  +downstreamnt
atgctcaggggcccggggccccggctgctgttgctggccgtcctgtccctggggacagcg
gtgccctccaccggagcctcgaagagcaagaggcaggctcagcaaatcattcagccccag
accccagtggctgtcagccagagcaagcctggctgttatgacaatgggaaacactatcag
ataaaccaacaatgggagcgcacctacctgggaaatgccttggtttgtacctgttatgga
gggagccgaggatttaactgcgagagtaaacctgaacctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgccctaaagactccatgatc
tgggactgtacctgcattggagctgggcgagggaggataagttgtaccattgcaaaccgt
tgccatgaaggcggtcagtcctacaagatcggtgacacgtggaggagaccacatgagacc
ggcggttacatgttggagtgtgtgtgccttggtaatgggaaaggagaatggacctgcaag
ccgatagctgagaaatgttttgatcatgctgctggaacttcctacgttgttggagaaact
tgggaaaagccatatcaaggctggatgatggtggattgtacctgtctgggagaaggcagt
ggacgtatcacctgtacttctagaaacagatgcaatgaccaggacaccaggacatcctac
cgaattggagacacgtggagcaagaaggataatcgggggaacctgctccagtgcatctgc
acgggcaacggcaggggggagtggaagtgtgagaggcatgcggctctgcagaccacgtcc
gctggatctggctccttcacagatgtccgaaccgccatttaccagccccagcctcacccc
cagcctgctccatacggtcactgtgtcacagacagtggtgtggtttactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctgtgcacttgcctgggcaatggtgtc
agctgccaagagacagctgtaacccaaacctacggtggcaattcaaacggggagccgtgt
gtcttaccattcacctacaacggcaggactttctactcctgcaccacagaagggcgacag
gatggacatctctggtgcagcacaacttccaattatgagcaagaccagaaatattccttc
tgtacagaccatactgttttggttcagactcgaggtggaaattccaatggtgccttgtgc
cacttccccttcctgtacaacaaccacaactacacggactgtacttctgagggcaggagg
gacaacatgaagtggtgtggaacaacggagaactacgatgctgaccagaagtttggattc
tgccccatggccgcccacgaggaaatctgcacaaccaatgaaggggtcatgtatcgcatt
ggagatcagtgggacaaacagcatgatatgggccacatgatgaggtgcacatgcgttggg
aatggtcgtggagaatggacttgtgtcgcctactctcagctccgagatcagtgtattgtt
gacgacatcacttacaacgtgaatgacacattccacaagcgtcatgaagaggggcacatg
ctgaattgtacctgctttggtcagggccggggcagatggaaatgcgatcccgttgaccaa
tgccaggattcagaaacccgaacattttatcaaattggagactcctgggagaagtacgtg
catggtgtcaggtaccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttgcagacctatccaggcacaactggccctgtccaagtcatcatcactgagaccccc
agtcagcccaattctcaccccatccagtggaatgcaccagagccatctcacatttccaag
tacattctcagatggaaacctaaaaattctccacgcggttggaaggaagccaccattcct
ggccacttgaattcctacaccatcaaaggcctgaccccaggtgtggtatatgagggacag
ctcatcagtgttcagcactacggccacagagaggtgacacgctttgacttcaccaccacc
agcacgagcacagcagtgactagcaacactgtgacaggagagacgacacccctttctccc
gttgtggccacttctgaatctgtgaccgaaatcacggccagcagctttgtggtctcatgg
gtctcggcatcagacaccgtgtcaggattccgtgtggaatacgagctaagtgaggaggga
gatgaaccacagtaccttgatcttccaagcacggccacttctgtgagcatccctgacctg
cttcctggacgaaaatacattgtaaatgtctatcagatatctgaagaaggagagcagagt
ctgatcctgtctacttcacagacaacagcgcctgatgcgcctcctgaccctgccgtggac
cgagttgatgacacctcgattgttgttcgctggagcagaccccaggcacccatcacagga
tacagaatagtgtactcgccatcagtagaaggtagtagcacagaacttaaccttcctgaa
accgccaactccgtcaccctcagtgacttgcaacctggagttcagtataacatcacgatc
tacgctgtggaagaaaatcaagaaagtactcctgttttcatccagcaagaaaccactggt
gtcccgcgttcagataaagttcccccacccaaggacctgcagtttgtggaagtgactgac
gtcaagatcaccatcatgtggacaccccctcagagccccgtgacgggttaccgcgtggac
gtgatccccgtcaacttgcctggggagcacggacagaggctgcccattagcaggaacacc
tttgcggaggtcaccggattgtcccccggggtcacctatcacttcaaagtcttcgctgtg
aaccaagggagggagagcaagcctctgacggcagaacagacgaccaaattggatgctccc
actaacctccgatttaccaacgaaactgactccactgtcatcgtgacctggactccacct
cgggcccgcatagccgggtaccgactgaccgtggccctgacccggggaggccagcccaag
cagtacaacatagggccttctgcctcccagtacccgctgaggaatctgcagcctgcctct
gagtatactgcaaccctcatggctgtcaaaggcaaccaacagagccccaaagccactggc
gtctttaccacccgacagcctctcggctctgttccaccatacaacacagaggtcactgag
accaccattgtgatcacatggacacctgctccaaggattggttttaagctgggtgtacga
ccaagccagggaggggaagcaccacgagaagtgacttcagagtcaggaagcatcgttgtg
tctggcctgactccaggcgtggaatacatttacaccatctcggtcctgagagatgggcag
gagagagatacaccgattgtaaagaaagttgtgacaccattgtctccacccacaaacctg
cacctggaggcaaaccccgacaccggtgtgcttacagtgtcctgggagaggagcaccact
ccagacattactggctatagaattaccaccacccctacaaatggccaacagggatattct
ttggaagaagtggtccatgcagatcagagttcctgcacttttgaaaacctgagtcctggc
ttggagtacaatgtcagtgtttacactgtcaaagatgacaaggaaagtgcccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtgacagggctggagccgggcattgactatgacatcagcgttatcact
ctcattaatggcggagagagtgcccctactacactgacacagcaaacggctgtgcctcct
cccactgacctgcgattcaccaatatcggtccagacactatgcgtgtcacctgggcccca
cctccgtccattgaattgaccaacctcctggtgcgctactcccctgtcaagaatgaggaa
gatgttgcggagttgtccatctctccttcagacaatgcagtggtcttaacaaatctcctg
cctggcaccgaatatttggtcagtgtctccagtgtttacgaacaacacgagagcacacct
cttagaggaagacagaaaacaggtctcgattccccaactggcatagacttttctgatatc
actgcccactctttcaccgtccattggattgctcctcgagccaccatcactggctaccgg
attcgccatcaccctgagcacactggtggaagacctcgggaagatcgggtgcccccgtct
cggaattccatcaccctcaccaatctcactccaggcacagaatatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcctcccttaattggccaacagtcaacagtttctgat
gttccgagggacctggaagtcatcgccgccacccccaccagcctcctgatcagctgggat
gctcccgctgtcacagtgagatattacaggatcacctatggagaaacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtccacagctaccatcagtggcctgaaa
cctggagcggactacaccatcaccgtgtatgctgtcactggccgtggagacagcccagca
agcagcaagccaatttccattgattatcgaacagaaattgacaagccagcacagatgcaa
gtgactgacgttcaggaaaacagcattagtgtcagatggctgccttcaagttcccctgtt
actggctacagagtgaccactactcccaaaaatggcccaggaccatcaaaaactaaaact
gcgggtccagatcaaacagaaatgaccattgaaggcttgcagcccacagtggagtatgtg
gtcagtgtctacgctcagaatcgaaacggagagagtcagcctctggttcaaactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgaaccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacacagcagagctg
caaggcctcaggccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagccattcctgcaccaaccgacctgaag
ttcacccaggttacaccaacaagcctgaccgcccagtggacagcgcccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggaaaagactggaccaatgaaagaaatcaac
cttgctcctgacagctcatctgtggttgtatcaggactcatggtcgccaccaaatatgaa
gtgagcgtctatgcccttaaggacagtttgacaagcagaccagctcagggagtcgtcact
actctggagaatgtcagccctccaagaagggcccgtgtgactgatgctacggagaccacc
atcaccatcagctggagaaccaagactgagacaatcactggcttccaagttgatgccatc
ccagcaaacggccagactccaattcagagaaccattaagccagatgtcagaagctacacc
atcacaggtttacaacccggcatggactacaagatctatttatacaccctcaatgacaat
gctcggagctctcctgtggtcatcgatgcctccactgccattgatgcaccatccaatctg
cgtttcctggccaccacacccaactccttgctggtatcatggcagccaccccgtgccagg
attactggttacatcatcaagtatgagaaacctgggtcccctcccagagaagtggtccct
cgtcctcgccctggtgtcacagaggctactattactggtctggaaccagggaccgagtat
accatccaagtcattgccctcaagaacaaccagaagagtgagcctctgattggaaggaaa
aagacagatgagcttccccaactggtaacccttccacaccccaatcttcacggaccagag
atcttggatgttccctccacagttcaaaagacccctttcatcaaccctgggtatgacact
ggaaacggtattcagcttcctggcacttctggtcagcagcccagtgttgggcaacaaatg
atctttgaggagcatggttttaggcgcaccacaccgcccacaacggccacccctgtaagg
cataggccaagaccatatccgccgaatgtaaatgaggagatccaagttggtcatgtcccc
aggggagacgtagaccatcacctctaccctcacgttctgggactcaatccaaatgcctct
acaggacaagaagctctctctcagacaaccatctcttggaccccattccaagaaagctct
gagtatatcatttcatgtcatcccgttggcattgacgaagaacctttacagttccgagtt
cctggaacttcggccagtgccaccctgacaggcctcaccagaggggccacctacaacatc
atagtggaggcactgaaagaccacaagaggcacaaggttcgggaggaggtcgttaccgtg
ggcaactctgtcgaccaaggcctaaaccaacctacaggtgactcgtgcttcgacccctac
acggtttcccatcatgccgtcggagaggagtgggagcggctgtctgaatctggctttaag
ctctcgtgccagtgcttgggctttggcagtgggcatttcagatgtgactcatctaaatgg
tgccatgacaatggcgtgaactacaagattggagagaagtgggatcgtcagggggagaat
ggccagatgatgagctgcacctgtcttggaaatggaaaaggagaattcaagtgtgatcct
catgaggcaacgtgctatgatgatgggaagacataccatgtaggagaacagtggcagaag
gaatatcttggcgccatttgctcctgcacatgctttggaggccagcggggctggcgctgt
gacaactgccgaagaccaggggctgaacctggtcacgaaggctccaccggccactacaac
cagtactcgcagagataccaccagagaacgaacactaatgtcaactgcccaattgaatgc
ttcatgcctttagatgtacaggctgacagagaagattcccgagagtga

DBGET integrated database retrieval system