KEGG   Felis catus (domestic cat): 101081819
Entry
101081819         CDS       T02385                                 
Symbol
DDIT3
Name
(RefSeq) DNA damage-inducible transcript 3 protein
  KO
K04452  DNA damage-inducible transcript 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04932  Non-alcoholic fatty liver disease
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05020  Prion disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05202  Transcriptional misregulation in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101081819 (DDIT3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101081819 (DDIT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101081819 (DDIT3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101081819 (DDIT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081819 (DDIT3)
   05012 Parkinson disease
    101081819 (DDIT3)
   05014 Amyotrophic lateral sclerosis
    101081819 (DDIT3)
   05020 Prion disease
    101081819 (DDIT3)
   05022 Pathways of neurodegeneration - multiple diseases
    101081819 (DDIT3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101081819 (DDIT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101081819 (DDIT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101081819 (DDIT3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    101081819 (DDIT3)
SSDB
Motif
Pfam: GAS bZIP_2 CLZ C_Hendra DivIC NAM-associated Gcd10p DUF5595 bZIP_1 DASH_Spc19 Phlebovirus_NSM IFP_35_N WDCP AC_N eIF3_subunit Fungal_TACC
Other DBs
NCBI-GeneID: 101081819
NCBI-ProteinID: XP_006933910
Ensembl: ENSFCAG00000002084
UniProt: M3VXV5
LinkDB
Position
B4:complement(85951817..85955898)
AA seq 167 aa
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGATYVSPPGNEEESKTFTTLDPASLA
WLTEEPGPAEVTNTSQSPHSPDSIQSSLAQEEEEEDQERPRKRKQSGQSLAGAGKQRMKE
KEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHKA
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcagccgagtcattgcctttttccttcgggacactgtccagctgggagctggaagcc
tggtatgaggacctgcaggaggtgctgtcctcagatgaaaatggggctacctatgtttca
ccccctggaaacgaggaagaatcaaaaacttttaccactcttgaccctgcctctctggct
tggctaactgaggagccaggaccagcagaggtcacgaacacctcccagagccctcactct
cctgattccattcagagctccctggctcaggaggaagaagaggaagaccaagaaagaccc
aggaagcggaaacagagtggccagtccctagctggagctggaaagcaacgcatgaaggag
aaagaacaagagaatgagagaaaagtggcacagctagctgaagagaatgaacggctcaag
caggaaatcgaacgcctgaccagggaagtggaggcaactcgccgagctctgattgaccga
atggttaatctgcacaaagcgtga

DBGET integrated database retrieval system