KEGG   Felis catus (domestic cat): 101082667
Entry
101082667         CDS       T02385                                 
Name
(RefSeq) B2 bradykinin receptor isoform X1
  KO
K03916  bradykinin receptor B2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04071  Sphingolipid signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04610  Complement and coagulation cascades
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05142  Chagas disease
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101082667
   04071 Sphingolipid signaling pathway
    101082667
   04022 cGMP-PKG signaling pathway
    101082667
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101082667
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101082667
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101082667
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101082667
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082667
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082667
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101082667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101082667
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Peptide
   Bradykinin
    101082667
SSDB
Motif
Pfam: 7tm_1 DUF2976
Other DBs
NCBI-GeneID: 101082667
NCBI-ProteinID: XP_006933147
Ensembl: ENSFCAG00000006779
LinkDB
Position
B3:141235305..141300198
AA seq 392 aa
MFSSWRRHMFVSFHEDPVPTTATFGGEMLNITSQVLESTLNGTSSQGCVYAEWWSWLNAI
QAPFLWVLFVLAALENIFVLGVFCLHKSSCTVAEIYLGNLAVADLILACGLPFWAITIAH
NFDWLFGEVLCRVVNTMLYMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSL
VIWGCTLLLSSPMLAFRTMKEYAAEGYNVTACIIVYPSRTWEVFTNVLLNSVGFLLPLVV
ITFCTVQIMKVLRNNEMQKFKEIQTERKATVLVLAVLLLFVTCWLPFQVSTFLDTLLRLN
ILSGCWDEHIVDVFTQIASYMAYSNSCLNPLVYVIVGKRFRKKSREVFRGLCQKGGCVSE
STKTENSMGTLRTSISVERQIHRLPEWVGNSQ
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgttctcttcctggaggagacatatgttcgtgtcttttcatgaggaccccgtgcccacc
acagccactttcggcggcgaaatgctcaacatcacctcgcaggtgcttgagtccactctc
aacgggacgtcgtcccagggctgcgtctatgccgagtggtggagctggctcaacgccatc
caggctcccttcctctgggtcctgttcgtgctggcggccctcgagaacatcttcgtcctc
ggcgtcttctgcctgcacaagagcagctgcacggtggccgagatctacctgggcaacctg
gccgtggcggacctgatcctggcctgcgggctgcccttctgggccatcaccatcgcccac
aacttcgactggctttttggggaggtcctctgccgcgtggtgaacaccatgctctacatg
aatctgtacagcagcatctgcttcctgatgctggtgagcatcgaccgctacctggccctg
gtgaaaaccatgtccatgggccggatgcgcggggtgcgctgggccaaactctacagcctg
gtgatctgggggtgcacgctgctcctgagttcgcccatgctggccttccggaccatgaag
gagtacgcggccgagggctacaacgtcacggcctgcatcatcgtctacccgtcgcgcacc
tgggaggtgttcaccaacgtgctcctgaactccgtgggcttcctgttgcccctggtcgtc
atcaccttctgcacggtgcagatcatgaaggtgctgcgcaacaacgagatgcagaagttc
aaggagatccagacggagaggaaggccacggtgctggtcctggccgtgctgctgctgttt
gtcacctgctggctgcctttccaggtcagcaccttcctggacacgctgctgcgcctcaac
atcctgtccggctgctgggatgagcacatcgtcgacgtcttcacgcagatcgcgtcctac
atggcctacagcaacagctgcctcaacccgctggtgtacgtgatcgtgggcaagcgcttc
cgcaagaagtcacgggaggtgttccggggactgtgccagaaggggggctgcgtgtcggag
tccaccaagacggagaactccatgggcacgctacggacctccatctcggtggaacgccag
attcacagactgcccgagtgggtggggaacagccagtga

DBGET integrated database retrieval system