KEGG   Felis catus (domestic cat): 101082837
Entry
101082837         CDS       T02385                                 
Symbol
WASF2
Name
(RefSeq) wiskott-Aldrich syndrome protein family member 2
  KO
K05748  WAS protein family, member 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04520  Adherens junction
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05100  Bacterial invasion of epithelial cells
fca05135  Yersinia infection
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101082837 (WASF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101082837 (WASF2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101082837 (WASF2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082837 (WASF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101082837 (WASF2)
   05100 Bacterial invasion of epithelial cells
    101082837 (WASF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101082837 (WASF2)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     101082837 (WASF2)
SSDB
Motif
Pfam: WH2 GBR2_CC RasGAP WASH_WAHD
Other DBs
NCBI-GeneID: 101082837
NCBI-ProteinID: XP_006934523
Ensembl: ENSFCAG00000007866
UniProt: M3W8J1
LinkDB
Position
C1:complement(20631350..20705092)
AA seq 498 aa
MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIVGELFTQANT
FASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPV
LETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRK
EKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGPSGYPPTLVYQNGSIGSVEN
MDGSSYPPPPQSDSTSPPSPSFSEDSLPPPPVEFSCPADSNQRGSGLAGPKRSSVVSPSH
PPPAPPLGSPPGSKPGFAPPPAPPPPPPVMGVPPPPPPGGFGSPGTPPPPSPPSFPPHPN
FAAPPPPPPPPAADYPTLPPPPLSQPVIGAPPPPPPPPPPGPPPLPFSGVDDQPVAPPPL
ADATKPKSSLPPVSDARSDLLSAIRQGFQLRKVEEQQEQEKRDVVGNDVATILSRRIAVE
YSDSEDDSSEFDEDDWSD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgccgttagtaacgaggaacatcgagccaaggcacctgtgccgtcagacgttgcctagc
gttagaagcgagctggaatgcgtgaccaacatcaccctggcaaatgtcatccgacagctg
ggcagcctgagtaaatatgcagaggacattgttggagagctctttactcaggcaaatacc
tttgcctctcgggtaagctcccttgctgagagggtcgaccgcctacaagttaaagtcact
cagctggatcccaaggaagaagaagtgtcactgcaaggaatcaacacccgaaaggccttc
agaagctctaccattcaagaccagaagcttttcgacagaaactctctcccagtacctgtc
ttagaaacatataacacctgtgatactcctccacctctcaacaatcttaccccttacagg
gacgatgggaaagaggcactcaaattctacacagacccttcgtacttctttgatctttgg
aaggagaagatgctgcaggacaccaaggatatcatgaaagagaagagaaagcataggaaa
gaaaagaaagataatccaaatcgagggaatgtaaatccacgtaaaatcaagacacgtaag
gaagagtgggagaagatgaagatgggacaagaatttgtggaatccaaagaaaagctgggg
ccttctgggtatccgcccaccttggtgtaccagaatggcagtattggctctgttgaaaat
atggatggaagcagctacccaccaccgccgcagtcagattccacttctccaccttctcct
tccttctctgaggacagcttgcctcccccacctgtagaattcagctgccccgcagacagc
aaccaaagagggtccggtttagctggacccaaaagatccagtgtggtcagcccaagccat
ccaccaccagcgcctcctctgggctctcctccaggctccaaacccgggtttgctccacca
cctgctcctccacctccacctccagtgatgggcgttccacccccaccaccgcctggagga
tttgggtctccggggaccccaccaccaccttcacccccatctttcccacctcaccccaat
tttgctgcccctccgcctcctcccccaccgcccgcagctgactacccgactctgccacca
cctcccttgtcccaaccagtgataggcgcacctcctcctccccctcctccccctcctccg
gggccccctcctctccctttcagtggtgtggatgaccagcctgttgcacccccaccactt
gccgatgccaccaagcctaagtcgtccttgcctcctgtgagcgatgcccgcagtgactta
ctttcagccatacgtcaaggctttcagctgcgaaaggttgaggagcaacaagaacaagag
aagcgggatgttgtgggcaacgatgtggccaccatcttgtcacgtcgaattgctgtggag
tacagtgactcagaagatgattcctctgagtttgatgaggacgactggtcggattaa

DBGET integrated database retrieval system