KEGG   Felis catus (domestic cat): 101082884
Entry
101082884         CDS       T02385                                 
Symbol
TICAM1
Name
(RefSeq) TIR domain-containing adapter molecule 1
  KO
K05842  toll-like receptor adapter molecule 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05133  Pertussis
fca05135  Yersinia infection
fca05142  Chagas disease
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101082884 (TICAM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082884 (TICAM1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101082884 (TICAM1)
   04621 NOD-like receptor signaling pathway
    101082884 (TICAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101082884 (TICAM1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101082884 (TICAM1)
   05160 Hepatitis C
    101082884 (TICAM1)
   05164 Influenza A
    101082884 (TICAM1)
   05168 Herpes simplex virus 1 infection
    101082884 (TICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101082884 (TICAM1)
   05165 Human papillomavirus infection
    101082884 (TICAM1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101082884 (TICAM1)
   05133 Pertussis
    101082884 (TICAM1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101082884 (TICAM1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101082884 (TICAM1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101082884 (TICAM1)
SSDB
Motif
Pfam: TRIF-NTD RHIM TIR_2
Other DBs
NCBI-GeneID: 101082884
NCBI-ProteinID: XP_023106646
LinkDB
Position
A2:complement(3649330..3660713)
AA seq 720 aa
MACTGPSLSGAFDILGAAGQDKLLYLKHKLKTVHQGCRGADLLYAMVLLKLGQETEARIS
LEALRADAAARLVARRWAGVDSAEAPEEPPDLSWAIARVYHLLAEEKLCPAPVRDLAYQT
ALQTFSSRDDHRLAELQGEARDRCGWGVIRAPGSFQPLRSDRGCLPPSSVSPSGTRSLPK
PIEGLSGWSRGCSLRSTSSPASLASNLEISQSPTVPLLSQHRGCRAPSKLCEEPRAGPGP
EPEPAPTGCQEPEEVSWPPSEESVNPSPGDTAGPPSGVTAGPLLGETAGPSSEGPSLEDP
SSGETAGPQMAPDSPGPRLPEVVPDASPTGQPDAPKALESGTRYPVECSHALAAPASLPL
PPKTTCPDKDQTPLSLPVEDTASQRTPPCPPTPSAPRTSAPCPSPSIPPSACSAAWNPCP
PPPELEPEQKFYNFVILHAGADEDIALRVRERLESLGVPDGATFCEDFQVPGRGHLRCLQ
DALDHSAFTLLLLTPNFDCHLGLHQAGQSLMNSLTRHECGDCVIPFLPLESSLEQLSPHT
CSLLTSLVWLDERSQIFARKVANTFKPQRLRARRAHWRKEQDVRALQEQRQQLEGERQRV
SALNAAYSAYFQSHSAWQAQMETLRVAFGSHMPFGTPGPLGAPPPFPSWPGHQPPPPAPP
WLAGAPAPAPAFPQPPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGTQAPEDKTQGAE
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcctgcacgggcccgtcgctctccggcgccttcgacattctaggtgccgcaggccag
gacaagctcttgtaccttaagcacaagctgaagacggtccaccagggctgccgaggggca
gacctcctgtacgccatggtgcttctgaagctgggccaggagacggaggccaggatctcc
ctggaagctctgagggcggacgcagcggcccggctcgtggcccgccgctgggccggcgtg
gacagcgccgaggccccggaggagcccccggacttgtcctgggccattgcccgggtgtac
cacctgctcgccgaggagaagctgtgcccggcccctgtgcgggacctggcctaccagaca
gccctccagacgttcagctccagggacgaccaccggctggccgagctccagggagaggcc
cgggaccggtgcggctggggcgtcatccgggctcccgggagcttccagccccttcgctcc
gatcggggctgcctcccgccatcctcggtgtccccctcgggcacccgcagccttcccaag
cccatcgagggcctttcgggctggagcagagggtgttctctgagatccaccagcagcccc
gcctccctcgccagcaacctggaaattagccagtcacccactgtgcctcttctcagccag
caccgcggctgtcgtgcgcccagcaagctgtgtgaggagccccgggcaggccccgggccc
gaacctgaacctgcccccacaggctgccaggaacctgaggaagtgagctggccaccatcc
gaggagtctgtcaacccttcacctggggacacagccggccctccatcgggggtgactgcc
gggcccctgctgggggagaccgctggcccctcatcggagggcccctctttggaggacccc
tcatcgggagagactgccggcccccagatggcaccagacagcccgggccctagacttcct
gaggtggtcccagatgcaagccccactggccagcccgacgcccccaaagctctggaaagc
ggcacccgctacccggtggagtgcagccacgcgctggccgcccccgcatctctccccttg
ccccccaaaaccacttgccctgacaaggaccagaccccactctcactccctgtagaagat
accgcttcccagaggacccccccatgcccccccaccccctcggccccgaggacctccgcg
ccctgcccttctccatccatccctccttccgcttgctccgccgcctggaatccgtgcccc
ccgccccccgagttggagccagagcagaaattctacaactttgtgatcctgcacgcgggg
gcagacgaggacattgccctgcgggtccgagagaggctggagagcctgggcgtcccggat
ggcgccaccttctgcgaggatttccaggtgcccgggcgcggccacctgcgctgcctgcag
gacgccctcgaccactcagccttcaccctcctgctgcttacccccaacttcgactgccac
ctgggcctgcaccaggcgggccagtccctgatgaacagcctcacgcggcacgagtgtggg
gactgcgtgatccccttcctgcccctggagagctcgctggagcagctcagcccgcacacc
tgcagcctgctcaccagcctggtgtggctggacgagcgctcccagatcttcgccaggaag
gtggccaacaccttcaagccgcagaggctgcgagcccgcagggcccactggaggaaggag
caggacgtccgcgccctgcaggagcagcgccagcagctggagggagagcggcagcgcgtc
tcggcgctgaacgccgcctactcggcctatttccagagccactcggcctggcaggcgcag
atggagacgctccgggtggccttcgggagccacatgccctttgggactccggggcccctg
ggagcgcccccgccctttccctcctggccgggccaccagccgccgccgcccgcgcccccg
tggctggccggcgccccggcacccgcgcccgccttcccgcagcccccggcgccccctcag
agcccggggctgcagcccctcatcatccaccacgcgcagatggtgcagctgggcctcaac
aaccacatgtggaaccagagagggacccaggcgcccgaggacaagacgcagggcgcggag
tga

DBGET integrated database retrieval system