KEGG   Felis catus (domestic cat): 101082969
Entry
101082969         CDS       T02385                                 
Symbol
TSC2
Name
(RefSeq) LOW QUALITY PROTEIN: tuberin
  KO
K07207  tuberous sclerosis 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04115  p53 signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04218  Cellular senescence
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101082969 (TSC2)
   04151 PI3K-Akt signaling pathway
    101082969 (TSC2)
   04152 AMPK signaling pathway
    101082969 (TSC2)
   04150 mTOR signaling pathway
    101082969 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101082969 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101082969 (TSC2)
   04218 Cellular senescence
    101082969 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101082969 (TSC2)
   04919 Thyroid hormone signaling pathway
    101082969 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    101082969 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082969 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082969 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101082969 (TSC2)
   05163 Human cytomegalovirus infection
    101082969 (TSC2)
   05165 Human papillomavirus infection
    101082969 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101082969 (TSC2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101082969 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP HEAT Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 101082969
NCBI-ProteinID: XP_023102822
Ensembl: ENSFCAG00000011746
LinkDB
Position
E3:complement(42868186..42903626)
AA seq 1804 aa
MAKPTSKDSGLKEKFRILFGLGTPRPNPRSAEGKQTEFIITAEILRELSVECGLNNRIRV
IGQICEVAKTKKFEEHAVEALWKAVEDMLQPERPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFKVIKDYPSNEDLHERLEVFKALTDNGRHITYLEEELAGFVLQWMDIGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCVQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTVNVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSVTRLIKKYRRELQAVTWDI
LLDIIERLLQQLQSLDSPELRAIVHDLLTTVEELCDQNEFHGSHERYFELVERCADQRPE
SSLLNLITYRAQSIHPAKDGWIHNLQLLMERFFRNESRSAVRIKVLDVLSFVLLINRQFY
EEELISSVVISQLSHIPEDKDPQVRKLATQLLVDLAEGCHTHHFNSLLDIVEKVMARSLS
APPELEERDVVAYSASLEDVKTAVLGLLVILQTKLYALPASHAVRVYETLVSHLQLHYKH
GYTLPIASSIRLQAFDFLLLLRADSLHRLGLPSKDGAVRFSPYCVCDSTEPERGSEKKAG
GPLSPPTGPSGPAPAGPAVRLGSLPYSLLFRVLLQCLKQETDWKVLKLVLGKLPESLRFK
VLIFTSPCSVDQLSSALCSMLSGPRTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKARQREMVYCLEQGLIYRCASQCVVALAVCSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVREFQESSAADAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGELQGSPELSSDPSAHVRQTKEAPAKLESQAGQQVCRGARDRVRSMSGGHGLRVG
ALDAQATHCPGAQTTPASTSERASAAAQLPAQEKTSLAAYVPLLTQGWAEILVRRPTGNT
SWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKERRDTALYKSLSVPAAGSAKPPPP
PRSNTVASFSSLYQTSCQGELHRSISWADSAVVLEEGSPSETDLPGEPTELEDFEATLGP
ERRCRRPEAYSRSSSSSSQEEKSFAAEEVAAGGLPIGRAVSAEGARPSAGLSFQPAQPLS
KSSSSPELQTLQDTLGDPGDKADVGRLSPEAKARSQSGTLDGAGAAWSTPGEESQGRGPA
RPEGPLPSGCPRSPGGLRPRGYTISDSAPSRRGKRVERDAFKSRAGASNTEKVPGINPSF
VFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSSSELAI
LSNEHGSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHI
ATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIITPLDYECN
LVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWI
ARLRHIKRLRHRIREEAHYSNPSLPLTQTHPPGHAKAPAEPTPTYETGQRKRLISSVDDF
TEFV
NT seq 5415 nt   +upstreamnt  +downstreamnt
atggccaagccgacaagcaaggattcaggcttgaaggagaagttcaggattctgtttgga
ctgggcaccccgcggccaaaccccaggtctgcagagggcaagcagacggagtttatcatc
acggcggaaatcctgagagagctgagcgttgaatgtggcctcaacaatcgcatccgggtg
atagggcagatctgtgaagttgcaaaaacgaagaagtttgaagagcatgcagtggaagcg
ctctggaaggccgtcgaggacatgctacagccagagcggccaccggaggcccggcatgcg
gtgctggctctgctgaaggccatcgtgcaggggcagggggaccgcttgggcgttctcagg
gccctcttctttaaggtcatcaaggattacccctctaatgaagatctccacgaaagactg
gaagttttcaaggccctcacagacaatgggagacacatcacatatttggaagaagaactg
gctgggtttgtgctgcagtggatggacatcggcctgtcctcagagttccttctggtgctt
gtgaacttggtcaaattcaacagctgttatctggatgaatacatcgcatcaatggtccac
atgatctgcctgctgtgtgtccagactgtgtcctccgtggacatagaggtctctctgcag
gtgctggacgccgtcgtctgctacaactgtctgccggctgagagcctgcccctgttcatc
gtcactctctgtcgtaccgtcaatgtcaaggagctctgtgagccttgctggaagctgatg
cgtaatcttctgggcacccacctgggtcacagtgccatctacaacatgtgccgcatcatg
gaggacagagcctacatggaagacgccccgctgctgagaggggccgtgttctttgtgggc
atggctctctggggggcgcaccgactctactcgctcaagaactccccgacatccgtgctg
ccgtcgttttacgaggccatgacctgtccgaacgaggtggtgtcctatgaaatcgtcctg
tctgtcaccagactcatcaagaagtaccggagggagctccaggctgtgacgtgggatatc
ctgctggacatcatcgaacgtctgctgcagcagctccagagcctggacagcccggagctc
agagccatcgtccatgacctgctgaccacagtggaggagctgtgtgaccagaatgagttc
cacggctcgcacgagagatacttcgagctcgtcgagagatgtgcagaccagaggccggag
tcctccctcctaaacttaataacctacagggctcagtccatccatccggcaaaggacggc
tggattcacaacctgcagttactgatggagagattcttccggaatgaatcccgcagtgct
gtgcgcatcaaggtgctcgatgtcctgtcctttgtgctgctcatcaacaggcagttctat
gaggaggagctgatcagctcggtggtcatctctcagctctcccacatcccggaggacaaa
gacccccaagtccggaaactggccacccagttgctggtggacctggccgaaggctgtcac
acccaccacttcaacagcctgctggacattgtggagaaggtgatggcccgctccctttcc
gcaccccctgagctggaggaaagagatgtggtggcatattcagcctccttagaggatgtg
aagactgccgtcttggggctcctggtgatccttcagaccaagctgtacgccttgcctgcc
agccacgcggtgcgtgtgtacgagaccctcgtcagccacctgcagctccactacaagcac
ggctataccctgcccatcgccagtagcatccggctgcaggcctttgacttcctgctgctg
ctgagggcggactccctgcaccgcctcggcctgcccagcaaggacggggctgtgaggttc
agcccctactgcgtctgcgactccacggagccagagagaggctctgagaagaaggccggc
ggccccctgtcgcctcccaccgggccgtccggcccagcacctgccggtcccgctgtgcgg
cttggctccctgccctactccctgctcttccgggtcctgctgcagtgcttaaagcaggag
acggactggaaggtgctgaagcttgttctcggcaagctgcccgagtccctgcgcttcaag
gtcctcatcttcacgtccccgtgcagcgtcgaccagctgtcttccgccctctgctccatg
ctttcaggtcccagaactctggagcggctccgaggcaccccggaaggtttctccaggacc
gacctgcacctggctgtggttcctgtgctgacggcgttaatctcttaccataactatttg
gacaaagccagacagcgggagatggtgtactgcctggagcaaggcctgatctaccgctgt
gccagccagtgcgtggtggccctggccgtgtgcagcgtcgaaatgcccgacatcatcatc
aaggcgctgcctgtcttggtcgtgaagctcacacacatttcggccacagccagcatggcc
attccactcctcgaattcctgtcaactctggccaggctgcctcacctctacaggaacttt
gccgctgagcagtacgcgagtgtgtttgccatctccctgccgtacaccaacccctccaag
tttaatcagtacatcgtgtgcctggcccatcacgtcatagccatgtggttcattagatgc
cgtctgccttttcggaaggattttgttccttatatcactaagggcctacgctccaatgtc
ctcctgtcttttgatgacaccccggagaaggacagcttcagagcgcggagcaccagtctc
aacgagaggcccaagagtttgaggatagccagaccccccaaacaaggcttgaataactcc
ccacccgtgagagaattccaggagagctctgcagccgacgccttccggtgccgcagcatc
agtgtgtctgaacatgtggtccgcagcaggatccagacgtccctcacgagtgccagcttg
gggtctgcggacgagaactcaatggcccaggctgacgacaacttgaaaaatctccacctg
gagctcacggagacttgtctggacatgatggccagatacgtgttctccaacttcacggcg
gtccccaagaggtcccctgtaggggagttcctcttggctggtggcaggaccaagacctgg
ctggttggaaacaagctcgtcactgtgacgacgagcgtggggaccgggacccggtcactg
ctgggcttggactcaggagagctgcagggcagcccagagctgagctctgaccccagtgcg
cacgtgaggcagacaaaggaggcgcctgccaagttggagtcccaggctgggcagcaggtg
tgccgtggggcccgggaccgcgtccgctccatgtctgggggccacggccttcgtgtcggt
gccttggacgctcaagccacccactgcccaggcgcacagaccacaccagccagcacgtcc
gagagggcctcggctgccgcccagctcccggcgcaggagaagacgagcctggcggcctac
gtacccctgctgacccagggctgggcggagatcttggtccggaggcccacggggaacacc
agctggctgatgagcctggagaaccccctcagccccttctcctcggacatcaacaacatg
cccctgcaggagctgtccaacgccctcatggccgccgagcgcttcaaggagcgtcgtgac
acggccctgtacaagtcactttcggtgccggcggccggctccgccaagccccctccgccc
ccacgttctaacacagtggcctctttctcctccctgtaccagaccagttgccaaggagag
ctgcacaggagcatttcctgggcagactccgcggtggttctggaggagggaagtcccagc
gagactgatttgccaggcgagcccactgagctggaggactttgaggccaccctgggccca
gagaggcgctgtcggcgccctgaagcctacagtaggtcgtcttccagctccagccaagag
gagaagtctttcgccgcagaggaggtggctgccggagggctccccatcgggcgggccgtg
tctgccgagggagcccggccctctgcggggctctccttccagcccgcccagcccctcagc
aagtctagctcctcgccggagctgcagaccctgcaggatacactcggggaccctggggac
aaggccgacgttggccggctgagccccgaggccaaggcccgctcacagtccgggactctg
gacggggcaggtgccgcctggtcaaccccaggtgaagagagtcagggccggggccctgcg
aggcccgagggtcccttgccttctggctgtccccgttcccccggtggcctgcgtcccaga
ggctacaccatttcggattcggccccgtcacgcagaggcaagagggtagagcgggacgcc
ttcaagagcagagctggggcctccaatactgagaaggtgccgggcatcaaccccagcttc
gtgttcctgcagctctaccactctcctttctttggcgacgagtccaacaagccgatcctt
ctgcctaacgagtccttcgagcgctcggtgcagctcctcgaccagatcccatcctacgac
acgcacaagatcgcggtcctgtacgtgggagaaggccagagcagcagcgagctcgccatc
ctgtccaacgagcacggctcgtaccggtacacagagttcctgacgggcctgggcaagctc
atcgagctcaaggactgccagccggataaggtgtacctgggcggtctggacgtgtgcggg
gaggacggccagttcacctactgctggcacgatgacatcatgcaggctgtcttccatatc
gccaccctgatgcccaccaaggacgtggacaagcaccgctgtgacaagaagcgccatctg
ggcaacgactttgtgtccattgtctataatgattccggcgaggacttcaaactgggcacc
attaaaggccagttcaacttcgtccacgtgatcatcacccccctggactacgagtgcaac
ctggtgtccctgcagtgcaggaaggacatggagggcctcgtggacaccagcgtggccaag
atcgtgtctgatcgcaacctgcccttcgtggcccgtcagatggctctgcacgccaacatg
gcctcccaggtgcaccatagccgctccaaccccacggatatctacccgtccaagtggatc
gccaggctccgtcacatcaagcggctgcgccaccggatccgtgaggaagcccactactcc
aaccccagcctgccgctgacgcagacgcaccctccgggccacgccaaggccccggccgag
cccacgcccacgtacgagacgggccagcggaagcgcctcatctcctctgtggatgacttc
accgagttcgtgtga

DBGET integrated database retrieval system