KEGG   Felis catus (domestic cat): 101082971
Entry
101082971         CDS       T02385                                 
Symbol
BATF3
Name
(RefSeq) basic leucine zipper transcriptional factor ATF-like 3 isoform X3
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101082971 (BATF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101082971 (BATF3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    101082971 (BATF3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ATG16 HALZ HAP1_N HAUS-augmin3 CCDC22 Eap1 DUF3450 Baculo_gp64 IFP_35_N Ribosomal_L30_N ZapB CENP-H HlyD_2 FapA DUF6592 DUF2205 TMF_DNA_bd Cnn_1N DivIC DUF6779
Other DBs
NCBI-GeneID: 101082971
NCBI-ProteinID: XP_011289348
LinkDB
Position
F1:32852030..32877632
AA seq 129 aa
MPPADRPWGARGSQGAQRDPAKPAVPPLGCASQSPEDDDRKVRRREKNRVAAQRSRKKQT
QKADKLHEEYECLEQENTVLRREIGKLTAELQQLSEALKEHEKMCPLLLCPMNFVPVPRP
DPVAGCLPR
NT seq 390 nt   +upstreamnt  +downstreamnt
atgccccccgcagacaggccctggggtgcccgcggctctcagggtgcgcagcgggacccg
gcaaagccggctgtccctcccctgggctgcgcctcgcagagtccagaggacgatgaccgg
aaggtccgaaggagagaaaaaaaccgagttgctgctcagagaagtcggaagaagcagacc
cagaaggctgacaaactccatgaggagtatgagtgcctggagcaggaaaacactgtgctg
cggagagagatcgggaagctgaccgcggagctgcagcagctgagcgaggccctgaaggag
cacgagaagatgtgcccactgctgctgtgccccatgaactttgtgccggtgccgcggccg
gaccccgtggccggctgcctgccccgatga

KEGG   Felis catus (domestic cat): 101095682
Entry
101095682         CDS       T02385                                 
Symbol
BATF2
Name
(RefSeq) basic leucine zipper transcriptional factor ATF-like 2 isoform X1
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101095682 (BATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095682 (BATF2)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    101095682 (BATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf HAP1_N HALZ DUF2205
Other DBs
NCBI-GeneID: 101095682
NCBI-ProteinID: XP_023095807
Ensembl: ENSFCAG00000006248
LinkDB
Position
D1:complement(110180944..110188404)
AA seq 275 aa
MHLCEGNALLTRTDPEEHQRLKKKQRNRAAAQRSRQKHTDKADALHQQHETLEKHNRLLR
KEIQTLQAELGWWSRTLHAHERLCLMDCANRLAAVPPGCWGQTEQPPDPMPCGQYGFQEQ
PGLSQTPVSSPSAHQLSSHLRPHSSPGLLLSPLPSLSLGSTAAPAPPPQLSPSPVQSASP
TGSSLLRPSSKLDALLPNPPAQPAPLQPLGVEHPTRGKLGSPPDSASPALGLAGLQGGEH
KPVSAAAADRQGLGVDPGPHPLLAFPLLSSAQVHF
NT seq 828 nt   +upstreamnt  +downstreamnt
atgcacctctgcgagggcaatgcgctgctgacgaggacggaccccgaggagcatcagagg
ctgaagaagaaacagaggaaccgcgcggccgcccagcgcagccggcagaagcacacggac
aaggcggacgccctgcaccagcagcacgagacgctggagaaacacaaccgcttgctgcgg
aaggagatccagactctgcaagctgagctggggtggtggagccggaccctgcatgcgcac
gagcgcctgtgcctgatggactgtgccaaccgcttggctgcggtgccccctggctgctgg
ggccagactgagcagcccccggaccccatgccctgtggacaatatggcttccaggaacag
ccgggcctgtcccagacccctgtctcttctccctcggcccaccagctctcttcacatctg
cggcctcatagttcccctggcctcctcctgtcccctctgccttctctgtcccttggctcc
accgcggcccctgcaccccctccccagctgtcccccagccctgtccagtcagcctcgccc
actggctccagcctgctaaggccttcctccaagctcgacgccctcctgcccaacccccca
gcccaacctgcccctctacagccccttggggtggagcaccccaccagggggaagctgggg
tccccacctgacagcgcctcacctgctctggggctggccggcctgcagggtggggagcac
aagcctgtgtcagcagcagcagcagaccggcaagggctgggtgtggatcccggtccccac
ccactcctggccttccccctgctctcctctgctcaagttcacttctaa

KEGG   Felis catus (domestic cat): 101097987
Entry
101097987         CDS       T02385                                 
Symbol
BATF
Name
(RefSeq) basic leucine zipper transcriptional factor ATF-like
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
fca  Felis catus (domestic cat)
Pathway
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101097987 (BATF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097987 (BATF)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    101097987 (BATF)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf APG6_N Phlebovirus_NSM Caudo_TAP HALZ Sec34 AAA_11 TMCO5 Seryl_tRNA_N
Other DBs
NCBI-GeneID: 101097987
NCBI-ProteinID: XP_003987898
Ensembl: ENSFCAG00000014194
UniProt: A0A2I2UY30
LinkDB
Position
B3:122779043..122803110
AA seq 125 aa
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEEMKYFTSVLSSHEPLCSVLAASTPSPPDVVYSAHAFHQPHVSS
PRFQP
NT seq 378 nt   +upstreamnt  +downstreamnt
atgcctcacagctcggacagcagcgactccagcttcagccgctctcctcccccgggcaag
caggactcatctgacgatgtgagaaaagttcagagaagggagaaaaatcgcattgctgcc
cagaagagccgacagaggcagacacagaaggctgacaccttgcacttggagagtgaagac
ctggagaaacagaacgcggctctgcgcaaggagatcaagcagctcacggaagagatgaag
tatttcacgtcggtgctaagcagccacgagcccctgtgctcggtgctggcggccagcacg
ccctcgccccccgacgtggtatacagcgcccatgccttccaccagcctcacgtcagctcg
cctcgcttccagccctga

DBGET integrated database retrieval system