KEGG   Felis catus (domestic cat): 101083160
Entry
101083160         CDS       T02385                                 
Symbol
RHEB
Name
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04218  Cellular senescence
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101083160 (RHEB)
   04151 PI3K-Akt signaling pathway
    101083160 (RHEB)
   04152 AMPK signaling pathway
    101083160 (RHEB)
   04150 mTOR signaling pathway
    101083160 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101083160 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    101083160 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101083160 (RHEB)
   04919 Thyroid hormone signaling pathway
    101083160 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    101083160 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    101083160 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101083160 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101083160 (RHEB)
   05163 Human cytomegalovirus infection
    101083160 (RHEB)
   05165 Human papillomavirus infection
    101083160 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:fca04031]
    101083160 (RHEB)
GTP-binding proteins [BR:fca04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    101083160 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14
Other DBs
NCBI-GeneID: 101083160
NCBI-ProteinID: XP_023106519
LinkDB
Position
A2:complement(165501332..165545406)
AA seq 184 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagaa
aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcagcttgttgac
acagctggacaagatgaatactccatctttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcac
ggcaaattgttggacatggtggggaaagtgcaaatacctattatgctggtcgggaataag
aaagatctacacatggaaagggtgatcagttatgaagaagggaaagcattagcagagtct
tggaacgcagcttttttggaatcttctgctaaagaaaatcagaccgctgttgacgttttt
agaaggataattttggaggcagaaaaaatcgatggggccgcgtcacaaggaaagtcttcc
tgctcggtgatgtga

DBGET integrated database retrieval system