KEGG   Felis catus (domestic cat): 101083271
Entry
101083271         CDS       T02385                                 

Symbol
GATA3
Name
(RefSeq) trans-acting T-cell-specific transcription factor GATA-3 isoform X1
  KO
K17895  GATA-binding protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04928  Parathyroid hormone synthesis, secretion and action
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101083271 (GATA3)
   04659 Th17 cell differentiation
    101083271 (GATA3)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101083271 (GATA3)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101083271 (GATA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101083271 (GATA3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    101083271 (GATA3)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon DZR_2 ArfGap Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 101083271
NCBI-ProteinID: XP_023112089
LinkDB
Position
B4
AA seq 444 aa
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PSYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSAGHSSPHLFTFPPTPPKDVSPDPSLSTPGSAGSARPDE
KECIKYQVPLPDSMKLESTHSRGSMTTLGGAASSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKAHDTLEDFPKSSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggtgacggcggaccagccgcgctgggtgagccaccaccaccccgcggtcctcaac
ggccagcacccggacacgcaccacccgggcctcggccactcctacatggacccggcgcag
taccccctgcccgaggaggtggatgtactttttaacatcgacggtcaaggcaaccacgtc
ccttcctactacggaaactcagtgagggccacggtgcagaggtaccctccgacccaccac
gggagtcaggtatgccgtccgcctctgctgcacggatccctgccctggctggacggcggc
aaagccctgggcagccaccacaccgcctcgccctggaacctcagccccttctccaagacg
tccatccaccacggctccccggggcccctctccgtctaccccccggcctcgtcttcctcg
ctgtcggcgggccactccagtccgcacctcttcaccttcccgcccaccccgccgaaggac
gtctcccccgacccgtcgctgtccaccccgggctcggccggctcggcgcggccggacgag
aaggagtgcatcaagtaccaggtgccgctccccgacagcatgaagctcgagtccacgcac
tcgcggggcagcatgaccaccctgggaggggcggcctcgtcggcccaccaccccatcacc
acctacccgccctacgtccccgaatacagctccggactcttcccgcccagcagcctgctg
gggggctcccccaccggcttcggatgtaagtcgaggcccaaggcgagatccagcacagaa
ggcagggagtgcgttaactgtggggccacctccaccccgctgtggcgacgtgacgggacc
gggcactacctgtgcaacgcctgtgggctctaccacaaaatgaacggacagaaccgaccc
ctcatcaagcccaagcgaaggctgtcggcagcgagaagagcgggaacgtcctgtgcaaac
tgtcagaccaccactaccactctctggagaagaaatgccaacggagaccccgtctgcaac
gcctgtgggctgtactacaaactacacaatattaacagacccctgactatgaagaaggaa
ggcatccagaccagaaaccggaaaatgtctagcaaatccaaaaagtgcaagaaggcacat
gacacgctggaggacttccccaagagcagctcgttcaacccggccgccctctccagacac
atgtcctctctcagccacatctccccgttcagccactccagccacatgctgaccaccccg
acgcccatgcacccgccgtccagcctctccttcggacctcaccacccgtccagtatggtc
accgccatgggttag

DBGET integrated database retrieval system