KEGG   Felis catus (domestic cat): 101083523
Entry
101083523         CDS       T02385                                 
Symbol
CLEC7A
Name
(RefSeq) C-type lectin domain family 7 member A isoform X3
  KO
K10074  C-type lectin domain family 7 member A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04613  Neutrophil extracellular trap formation
fca04625  C-type lectin receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101083523 (CLEC7A)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101083523 (CLEC7A)
   04625 C-type lectin receptor signaling pathway
    101083523 (CLEC7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101083523 (CLEC7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101083523 (CLEC7A)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    101083523 (CLEC7A)
   04090 CD molecules [BR:fca04090]
    101083523 (CLEC7A)
   04091 Lectins [BR:fca04091]
    101083523 (CLEC7A)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    101083523 (CLEC7A)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   101083523 (CLEC7A)
CD molecules [BR:fca04090]
 Proteins
  101083523 (CLEC7A)
Lectins [BR:fca04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   101083523 (CLEC7A)
SSDB
Motif
Pfam: Ly49 UL45 Claudin_2 DUF5706
Other DBs
NCBI-GeneID: 101083523
NCBI-ProteinID: XP_003988449
Ensembl: ENSFCAG00000031625
UniProt: A0A337SW69
LinkDB
Position
B4:complement(46501846..46515462)
AA seq 189 aa
MEYRSEVENLDEDGYTRLDFSSQGVTGRHAVSEKGTCATSPYWRPIAVTLGILCLVILVT
AVVLGTTAIWRPNSESNPLKNDNFPSRNKENYSQPTQSSLEDSVAPTKALTTTGVFSNSC
PPNWIIHENNCYLFRTSLASWNSSKKQCSQLHSNLLKIDSEKELVSDQKHRNSRKLISRL
RVDSPINNL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggaataccgttctgaggtagaaaatttggatgaagatggttatactcgtttagacttc
agctctcaaggcgtcactgggagacatgcggtctcagagaaaggaacttgtgctacgtct
ccttattggcgtcccattgccgtgaccttgggaatcctatgcttggtaatactggtgaca
gctgtggtcctgggtaccacggctatttggagacccaattcagaaagcaacccattgaag
aatgacaactttccatcaagaaataaagagaactacagtcaacccacacaatcatcttta
gaagacagtgtggctcctaccaaggctctcacaaccacaggagttttttccaactcttgt
cctcctaactggatcatacatgagaacaactgttatctatttaggacatcattagcttcc
tggaatagcagtaaaaaacaatgctctcaactgcactctaatctcctgaagatagacagt
gaaaaagaactggtttcagatcagaagcacagaaattcaagaaaactcatctcacgattg
cgtgtggattcacctatcaataatttatga

DBGET integrated database retrieval system