KEGG   Felis catus (domestic cat): 101083565
Entry
101083565         CDS       T02385                                 
Symbol
SELP
Name
(RefSeq) P-selectin isoform X1
  KO
K06496  selectin, platelet
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04613  Neutrophil extracellular trap formation
fca05144  Malaria
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    101083565 (SELP)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101083565 (SELP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101083565 (SELP)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101083565 (SELP)
  09174 Infectious disease: parasitic
   05144 Malaria
    101083565 (SELP)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101083565 (SELP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:fca04515]
    101083565 (SELP)
   04090 CD molecules [BR:fca04090]
    101083565 (SELP)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101083565 (SELP)
   04091 Lectins [BR:fca04091]
    101083565 (SELP)
Cell adhesion molecules [BR:fca04515]
 Selectins
  Selectin family
   101083565 (SELP)
CD molecules [BR:fca04090]
 Proteins
  101083565 (SELP)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   101083565 (SELP)
Lectins [BR:fca04091]
 C-Type lectins
  Group 4: Selectins
   101083565 (SELP)
SSDB
Motif
Pfam: Sushi Lectin_C EGF_2 EGF EGF_3
Other DBs
NCBI-GeneID: 101083565
NCBI-ProteinID: XP_019677151
Ensembl: ENSFCAG00000008148
LinkDB
Position
F1:complement(14187497..14229093)
AA seq 831 aa
MASCLKAIWNWRFQTVIFRTAQLLCFSALIFELIEQKEVAAWTYNYSTKAYSWNYSRMFC
QKHYTDLVAIQNKKEIAYLNDVMPYFNSYYWIGIRRINDKWTWVGTKKVLTKEAENWADN
EPNNKKNNQDCVEIYIKSVSAPGKWNDEPCWKKKRALCYTASCQDMSCSKQGECIETIGN
YTCSCFPGFYGPECEYVQECGEFGLPQHVLMNCSHPLGNFSFNSECSFHCAEGYELNGPS
KLKCLASGMWTNNPPQCIAAQCPPLKTPERGSMTCLPSPEAPQYQSSCHFACEEGFALVG
PEVVQCTASGVWTASPPGCEVVRCPLLEAPGKGTMDCVHPLTAFAYGSSCKFECEPGYQV
RGRATLRCIGSGQWTTPLPACEAIACEPLESPVHGSTDCSPLSGPLPYNTSCSFRCADGF
RLKGADMAQCTDLGRWTAPAPVCEALQCQDLPAPDQAQVNCSHPFGAFRYQSTCSFSCDE
GLLLVGAGELRCLGTGTWSAPPPQCQAFTCTPLLSPRNGTMTCVQPLGDSSYKSRCQFTC
DEGFSLSGPEILDCAPSGHWTGPPPTCEAIKCPELFAPEQGSLACSDTRREFSVGYTCHF
SCNKGFELEGSNDVECTASGKWTAPPPTCQAGVVSAPLSEVRCPALTTLEQGTVSCRHGL
GTFGPNTTCYFGCHAGFTLTGGRALRCRPSGQWTAGAPTCRAVKCSELHGTEPGTMNCSN
PWGNFSYGSTCSFHCPEGQLLNGSARTACQENGQWSTPMPTCQAGPLTIQEALTYFGGAV
ASTIGLVTCGTLLALLRKRFRQKDDGESPLNPQSHLGTYGVFTNAAFDPSP
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggccagctgcctaaaagccatctggaactggagatttcagacggtgatcttcagaact
gcccaactcctttgcttcagtgccctaatctttgaattaatagagcagaaagaagtggca
gcgtggacctataattacagcaccaaagcatattcatggaattattcccggatgttctgc
cagaagcattacacggatttagtggccatccagaataaaaaagagatcgcttacctcaac
gatgtcatgccttacttcaactcttactactggattgggatccgaaggatcaatgataaa
tggacctgggtgggaaccaaaaaggtcctcaccaaagaggccgagaactgggctgacaac
gagcccaacaacaagaagaacaaccaggactgtgtggagatctacatcaagagcgtgtcg
gcccctggcaagtggaacgatgagccctgctggaaaaagaagcgggccctatgctacaca
gcatcctgccaggacatgtcctgtagcaagcaaggagagtgcattgagaccatcgggaac
tacacctgctcctgcttccctggattctatggaccagagtgtgaatatgtccaagagtgt
ggggaatttggtctcccccaacatgtgctcatgaactgcagccaccctctcgggaacttc
tccttcaattcagagtgcagcttccactgcgccgaagggtacgaattgaatggacccagc
aagctgaaatgtttggcttctggaatgtggacaaataacccaccgcaatgtatagctgcc
cagtgcccacccctgaagactcctgagcgaggaagcatgacgtgtcttccctctccggaa
gcgccccagtaccagtccagctgccactttgcttgtgaagagggatttgcattagtcggg
ccagaggtggtgcagtgcacagcctcgggggtgtggacagcctcacccccagggtgtgaa
gttgtgcggtgtccgctcctggaagcccctggcaaaggaaccatggactgtgttcatccc
ctcactgcctttgcatatggctccagctgcaaatttgagtgtgaacctggctatcaagtg
agaggccgggccactctccgctgcattggctctggccagtggaccacacccttgccagcc
tgtgaggccattgcctgtgagccactggagagtccggttcatggaagcacggattgctcc
ccactctcgggaccgctgccatacaacaccagctgtagcttccgttgtgctgatggcttc
aggctgaaaggagctgacatggcccagtgtactgacttgggacggtggacagcgcccgcc
ccggtctgtgaagcgctgcagtgtcaggatcttccggctccagaccaggcccaggtgaac
tgctcccacccgtttggagcctttcggtaccaatccacctgcagcttctcctgtgacgag
ggcttactcctggtgggagcaggcgagctgcggtgcttgggtacggggacctggagtgct
cctcccccacaatgccaggcctttacctgcacacctctgctaagccctcggaatggaaca
atgacctgtgtccagcctcttggagattccagttataagtccagatgccaattcacctgt
gatgaaggattctctttatctggaccagaaatattggattgtgctccatctggacattgg
acaggtcccccaccaacatgtgaagccatcaagtgcccagaattatttgccccagagcag
ggaagcctggcttgttctgacacccgcagagaattcagtgttggctacacctgccatttc
tcctgtaacaagggctttgagctggagggatctaatgatgttgaatgcacagcttccgga
aaatggacagcacctccaccaacctgccaagcaggtgtggtatcagctcctctctcagag
gttcgatgcccagccctcaccaccctggagcagggaacagtgtcctgtaggcatggtctg
ggaacctttggcccgaataccacgtgttactttggatgccacgctggattcaccctcacg
ggaggccgtgctctcagatgcaggccttcgggacaatggacggcgggagctcccacgtgc
agagccgtcaagtgctctgagctgcatggtaccgagccaggcacgatgaactgctccaac
ccctggggaaatttcagctacggctcaacctgcagcttccattgtccagaaggccagtta
cttaatggctcagcaagaaccgcatgccaagagaatggccagtggtcaacccccatgcca
acctgccaagcggggccgctgactatccaggaagccctgacttactttggcggggcagtg
gcttctacaataggtttggtgacgtgtgggaccctcctggctctcctaagaaagcgtttc
aggcaaaaagatgatggagaaagccccttgaaccctcaaagccacctaggaacatacgga
gttttcacaaatgctgcatttgacccaagcccttaa

DBGET integrated database retrieval system