KEGG   Felis catus (domestic cat): 101083606
Entry
101083606         CDS       T02385                                 
Symbol
TAB1
Name
(RefSeq) TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 isoform X3
  KO
K04403  TAK1-binding protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101083606 (TAB1)
   04064 NF-kappa B signaling pathway
    101083606 (TAB1)
   04668 TNF signaling pathway
    101083606 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101083606 (TAB1)
   04621 NOD-like receptor signaling pathway
    101083606 (TAB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101083606 (TAB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101083606 (TAB1)
   05161 Hepatitis B
    101083606 (TAB1)
   05168 Herpes simplex virus 1 infection
    101083606 (TAB1)
   05169 Epstein-Barr virus infection
    101083606 (TAB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101083606 (TAB1)
   05135 Yersinia infection
    101083606 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101083606 (TAB1)
   05140 Leishmaniasis
    101083606 (TAB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101083606 (TAB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101083606 (TAB1)
SSDB
Motif
Pfam: PP2C PA14
Other DBs
NCBI-GeneID: 101083606
NCBI-ProteinID: XP_003989321
Ensembl: ENSFCAG00000011951
LinkDB
Position
B4:135120042..135152701
AA seq 504 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTSFVAQRLSAELLLGQLSAEHTEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLLPQYQKILERLKALEREISGGAMAVVAVLLNNRLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGVICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLEGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHGDTFASGGERAKFCPRHEDMTL
LVRNFGYPLGEMSQPAASPAPATGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQLVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVMTAP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcctgctgcagagtgagcagcagccaagctggacagacgac
ctgccgctctgccacctctctggggtgggttcagcctccaaccgcagctactctgctgat
ggcaagggcaccgagagccacccaccggaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtacggggtcttcaacggctatgatggcaaccgggtgaccagcttcgtg
gcccagcggctgtctgcagagctcctgctgggccagctcagcgcagagcacaccgaggcg
gacgtgcggcgtgtgctgctgcaggcctttgatgtggtggagaggagcttcctggagtcc
atcgatgacgcattggctgagaaggccagcctccagtcccagctgccagagggtgtccct
cagcaccagctgcttcctcagtaccagaagatcctcgaaagactcaaggcactggagagg
gagatttcgggaggagccatggctgttgtggcggtccttctcaacaacaggctctatgtc
gccaatgtcggtacaaaccgtgcccttttatgcaaatccacggtggacgggctgcaggtg
acccagctgaacgtggaccacaccacggagaacgaggacgagctcttccgcctctctcag
ctgggtttggatgcaggaaagatcaagcaagtgggggtcatctgtgggcaggagagcacc
aggcgcatcggggattacaaggtcaagtacggctacactgacatcgacctactgagtgcc
gccaagtccaagcctatcattgcagaacccgagatccacggtgcacagcccctggagggg
gtgaccggcttcctggtgctgatgtcggaggggctgtacaaggccctggaggcagcccac
gggcctgggcaggccaaccaggagatcgccgccatgatcgacactgagttcgccaagcag
acttccctggatgcggtggcccaggccgtggtggaccgggtgaagcgcatccacggtgac
acctttgccagtggcggggagcgtgccaagttctgccccaggcacgaggacatgaccttg
ctggtgaggaacttcggctacccactaggcgagatgagccagcccgcagcgtccccggcc
ccagctacaggaggccgcgtgtatcccgtgtccgtgccgtactccagcgcccagagcacc
agcaagaccagcgtgaccctctccctcgtcatgccctcccagggccagctggtcaatggg
gcccacagcgcctccaccctggatgaggccacccccaccctcaccaaccagagcccgacc
ctgaccctgcagtccaccaacacgcacacccagagcagcagctccagctcagacgggggc
ctcttccgctcccggcctgcccactcgctcccgcccggggaggatggccgggtcgagccc
tatgtggactttgccgagttttaccgtctctggagcgtggaccatggcgagcagagtgtg
atgacggcgccatag

DBGET integrated database retrieval system