KEGG   Felis catus (domestic cat): 101083611
Entry
101083611         CDS       T02385                                 
Symbol
MARCO
Name
(RefSeq) macrophage receptor MARCO
  KO
K13884  macrophage receptor with collagenous structure
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101083611 (MARCO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101083611 (MARCO)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101083611 (MARCO)
SSDB
Motif
Pfam: Collagen SRCR SRCR_2
Other DBs
NCBI-GeneID: 101083611
NCBI-ProteinID: XP_019693557
Ensembl: ENSFCAG00000014026
UniProt: M3WJY3
LinkDB
Position
C1:complement(121726013..121771316)
AA seq 486 aa
MENKEILKEDEFLASTGERETINQTMFPAMETFEINDPKSRKRKAVNCFTVMVAIYLVLL
TAGAGLLVVKVLNLQERLWALEMHFTNGTLAAEDSPSFSLLQSMPIPHLPGGALGLQVLQ
TQITQVRTRQEHLLRKVDNFTRNPELFGIKGERGAPGLPGLQGPPGIKGEAGLQGPSGTP
GKQGTPGTPGRQGEKGSKGDGGLAGLKGEPGAKGDKGDLGLPGSKGDMGMKGDTGVMGPP
GAQGSKGDSGKPGLPGAAGSPGMKGDQGQPGAQGLPGSPGAAGSPGAKGEPGSTGPPGLT
GPPGIPGMPGADGMKGSKGDSGLQGQKGTKGESGFPGPAGMKGSQGSPGLAGLKGAPGLK
GQKGEPGVKGSSGQQGIQGQKGQKGESLVSVRIIGTSSRGRAEVYYNGIWGTICDDDWDH
SDATVFCRMLGYSRGRALVNVTPGTGQIWLDNVACQGTEGTLWNCNKNSWGSHNCNHNED
AGVECS
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggaaaataaagaaattctcaaggaggacgagttcttggctagcactggagaaagagaa
actatcaaccaaaccatgttccctgcaatggagacctttgaaatcaacgatccgaagtcc
aggaagagaaaggcggttaactgcttcacggtcatggtggccatctacctggttctcctc
accgcaggtgccgggctgctggtggtaaaagttctgaatcttcaggagcggctctgggcc
ctggagatgcacttcaccaatggaacactggccgccgaggacagcccgtccttctctctg
ctccagtcaatgcccatcccgcacctccctgggggcgcgctggggctgcaagtcttacag
acccagatcacccaggtccgcaccaggcaggagcatctgctgcggaaggtggacaacttc
actcgaaacccagagctgttcgggatcaaaggggaacgaggcgctccaggcctcccggga
ctccaaggtccgcctggaatcaagggagaggcaggcctccaaggacccagcggcactcca
gggaaacaaggaacccctggcaccccaggacggcaaggagagaagggcagcaaaggtgac
gggggactcgctggcctgaaaggcgaacctggggctaaaggagacaaaggagacctgggc
ctcccaggaagcaagggagacatgggcatgaaaggagatacaggggtcatggggcccccc
ggagcccaggggagcaaaggtgactcagggaagccaggcctcccaggtgcggctggatct
cctggaatgaaaggagaccaaggacaacctggagcacagggtcttcccggctctccgggc
gcagcgggatccccaggtgccaagggtgagcccggcagcactggcccccccgggctgaca
ggaccaccagggatacctgggatgccaggagccgacggcatgaagggaagcaagggggac
tcaggacttcaaggacagaaaggaacaaaaggagaatcaggatttccaggccctgcaggc
atgaagggaagccagggaagcccaggcctggcaggcctcaagggtgcaccgggactaaaa
ggccaaaagggagagccaggagtgaaaggatcttctggacagcaaggaatacagggacaa
aaaggtcaaaaaggtgaatccctggtgtccgtcaggattatcggcactagcagccgaggc
cgggctgaagtttactataacggcatctgggggacaatttgtgacgacgactgggaccat
tcagatgccactgtcttctgccgcatgctgggctactccaggggaagggcccttgtcaat
gtgacacctggcactgggcagatctggctggataacgttgcatgtcaagggacagaaggg
accctgtggaattgcaacaagaatagctggggctctcacaactgcaaccacaatgaggat
gcaggcgtggaatgcagctga

DBGET integrated database retrieval system