KEGG   Felis catus (domestic cat): 101083715
Entry
101083715         CDS       T02385                                 
Symbol
SCARB1
Name
(RefSeq) scavenger receptor class B member 1 isoform X1
  KO
K13885  scavenger receptor class B, member 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04913  Ovarian steroidogenesis
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
fca04975  Fat digestion and absorption
fca04976  Bile secretion
fca04977  Vitamin digestion and absorption
fca04979  Cholesterol metabolism
fca05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101083715 (SCARB1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101083715 (SCARB1)
   04925 Aldosterone synthesis and secretion
    101083715 (SCARB1)
   04927 Cortisol synthesis and secretion
    101083715 (SCARB1)
  09154 Digestive system
   04976 Bile secretion
    101083715 (SCARB1)
   04975 Fat digestion and absorption
    101083715 (SCARB1)
   04979 Cholesterol metabolism
    101083715 (SCARB1)
   04977 Vitamin digestion and absorption
    101083715 (SCARB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101083715 (SCARB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101083715 (SCARB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101083715 (SCARB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101083715 (SCARB1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    101083715 (SCARB1)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101083715 (SCARB1)
SSDB
Motif
Pfam: CD36 PorA TMEM51
Other DBs
NCBI-GeneID: 101083715
NCBI-ProteinID: XP_023097052
LinkDB
Position
D3:5433260..5518174
AA seq 509 aa
MGSRARARRAAAMLGFLGLLCAVLGAVMIVMVPTLIKQQVLKNVRIDPSSLSFNMWKEIP
VPFYLSVYFFDVVNPSAVLLGEKPQVRERGPYVYREFRHKSNITFNDNDTVSFLEYRSFQ
FQPDRSHGLESDYIVMPNILVLGAAMMMENKPMSLKLIMTLAFSTLGERAFMNRTVGEIM
WGYEDPLVHLVNKYLPNMFPFKGKFGLFAELNNSNSGLFTVFTGVKDFSRIHLVDKWNGL
SKVKYWHSDQCNMINGTSGQMWAPFMTPETSLEFYSPEACRSMNLVYKESGVFEGIPTYR
FVAPSTLFANGSTYPPNEGFCPCLESGIQNISTCRFNAPLFLSHPHFYNADPMLAEAVLG
LHPNPEEHSLFLDVHPVTGIPMNCSVKLQLSLYVKAIKGIGQTGKIEPVVLPLMWFEESG
AMEGEPLQTFYTQLVLVPSVLHYAQYVLVGLGCVLLLIPIIHQIRSQEKCFLFWSSSKKG
SKDKEAIQAYSESLMTSAPKGSVLQEARL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggcagccgcgccagagcgcgccgggcggccgcgatgctgggcttcctcgggctgctg
tgcgccgtgctgggcgccgtcatgatcgtgatggtgcccacgctcatcaagcagcaggtg
ctcaagaatgtgcgcatcgaccccagcagcctgtccttcaacatgtggaaggagatcccg
gtccccttctacctgtccgtctacttcttcgacgtggtcaaccccagcgccgtcctcctg
ggcgagaagccgcaggtgcgggagcgcgggccctacgtgtacagggagttcaggcacaag
agtaacatcaccttcaatgacaatgacaccgtgtcattcctcgagtaccgcagtttccag
ttccagcctgacaggtcccacggcctggagagtgactacatcgtcatgcccaacatcttg
gtcttgggcgcggcgatgatgatggagaacaagcccatgagcctgaagctgatcatgacc
ttggcgttcagcaccctcggagagcgtgccttcatgaaccgcaccgtgggcgagatcatg
tggggctacgaggaccctctggtgcacctcgtcaacaagtacctgccaaacatgtttccc
ttcaagggcaagtttgggctctttgcggagctgaacaactccaattccgggctcttcacc
gtgttcacgggggtcaaagacttcagcaggatccatctcgtggacaagtggaacgggctt
agcaaggtcaaatactggcattctgaccagtgcaacatgatcaatgggacgtctggacag
atgtgggcgccgttcatgactcctgagacctcactggaattctacagccccgaggcctgc
cggtccatgaacctggtctacaaggagtcaggggtgttcgaaggcatccccacctatcgc
ttcgtggcccccagcaccttgtttgccaacggctccacctacccgcccaacgagggcttc
tgcccctgcctggagtctgggattcagaacatcagcacctgcaggttcaatgcacccttg
tttctctcccaccctcacttctacaacgccgacccgatgctggcagaggcggtgcttggc
ctccaccccaacccagaggaacattccttattcctggacgtacacccggtcaccgggatc
cccatgaactgctctgtgaaactacagctgagcctgtacgtcaaggccatcaaaggcatc
ggacaaacagggaagatcgagccagtagtcctgccgttgatgtggtttgaggagagcggg
gcaatggaaggtgagcccctgcagaccttctacacccagctggtgttggtgcccagtgtg
ctacactatgcccagtacgtcctcgtcgggctgggctgcgtcctgctgctcatccccatc
atccaccagatccggagccaggagaaatgctttttattttggagtagtagtaaaaagggc
tcaaaggataaggaggccattcaggcctattctgaatccctgatgacatcagcacccaag
ggctctgtgctgcaagaagcaagattgtag

DBGET integrated database retrieval system