Felis catus (domestic cat): 101084011 Help Entry 101084011         CDS       T02385                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism fca  Felis catus (domestic cat) Pathway fca04014   Ras signaling pathway fca04015   Rap1 signaling pathway fca04022   cGMP-PKG signaling pathway fca04024   cAMP signaling pathway fca04062   Chemokine signaling pathway fca04071   Sphingolipid signaling pathway fca04072   Phospholipase D signaling pathway fca04081   Hormone signaling fca04144   Endocytosis fca04150   mTOR signaling pathway fca04270   Vascular smooth muscle contraction fca04310   Wnt signaling pathway fca04350   TGF-beta signaling pathway fca04360   Axon guidance fca04510   Focal adhesion fca04520   Adherens junction fca04530   Tight junction fca04611   Platelet activation fca04621   NOD-like receptor signaling pathway fca04625   C-type lectin receptor signaling pathway fca04660   T cell receptor signaling pathway fca04670   Leukocyte transendothelial migration fca04722   Neurotrophin signaling pathway fca04810   Regulation of actin cytoskeleton fca04921   Oxytocin signaling pathway fca04928   Parathyroid hormone synthesis, secretion and action fca04972   Pancreatic secretion fca05100   Bacterial invasion of epithelial cells fca05132   Salmonella infection fca05133   Pertussis fca05135   Yersinia infection fca05152   Tuberculosis fca05163   Human cytomegalovirus infection fca05200   Pathways in cancer fca05203   Viral carcinogenesis fca05205   Proteoglycans in cancer fca05206   MicroRNAs in cancer fca05210   Colorectal cancer fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101084011 (RHOA)    04015 Rap1 signaling pathway     101084011 (RHOA)    04310 Wnt signaling pathway     101084011 (RHOA)    04350 TGF-beta signaling pathway     101084011 (RHOA)    04072 Phospholipase D signaling pathway     101084011 (RHOA)    04071 Sphingolipid signaling pathway     101084011 (RHOA)    04024 cAMP signaling pathway     101084011 (RHOA)    04022 cGMP-PKG signaling pathway     101084011 (RHOA)    04150 mTOR signaling pathway     101084011 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     101084011 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101084011 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101084011 (RHOA)    04520 Adherens junction     101084011 (RHOA)    04530 Tight junction     101084011 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101084011 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101084011 (RHOA)    04621 NOD-like receptor signaling pathway     101084011 (RHOA)    04625 C-type lectin receptor signaling pathway     101084011 (RHOA)    04660 T cell receptor signaling pathway     101084011 (RHOA)    04670 Leukocyte transendothelial migration     101084011 (RHOA)    04062 Chemokine signaling pathway     101084011 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     101084011 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     101084011 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     101084011 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     101084011 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101084011 (RHOA)   09158 Development and regeneration    04360 Axon guidance     101084011 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101084011 (RHOA)    05206 MicroRNAs in cancer     101084011 (RHOA)    05205 Proteoglycans in cancer     101084011 (RHOA)    05203 Viral carcinogenesis     101084011 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     101084011 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101084011 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101084011 (RHOA)    05135 Yersinia infection     101084011 (RHOA)    05133 Pertussis     101084011 (RHOA)    05152 Tuberculosis     101084011 (RHOA)    05100 Bacterial invasion of epithelial cells     101084011 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101084011 (RHOA)    05418 Fluid shear stress and atherosclerosis     101084011 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101084011 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101084011 (RHOA)    04031 GTP-binding proteins [BR:fca04031]     101084011 (RHOA) Membrane trafficking [BR:fca04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     101084011 (RHOA) Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101084011 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    101084011 (RHOA)   Exosomal proteins of colorectal cancer cells    101084011 (RHOA)   Exosomal proteins of bladder cancer cells    101084011 (RHOA) GTP-binding proteins [BR:fca04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     101084011 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  101084011 NCBI-ProteinID:  XP_023104555 Ensembl:  ENSFCAG00000027456 UniProt:  M3WU80 LinkDB All DBs Position A2:complement(18469961..18533079) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtcttcagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccggtgaaa ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system